PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

SBP

Protein Properties

Length: 180aa MW: 20724.2 Da PI: 9.9556

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00104877001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	132.1	1.9e-41	63	138	2	77
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 C v++C+a+lseak+y+rrhkvCevh+ka++++v+g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk + GSBRNA2T00104877001 63 CLVDRCTANLSEAKQYYRRHKVCEVHAKASSATVAGVKQRFCQQCSRFHELAEFDETKRSCRRRLAGHNERRRKIS 138 *************************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51141	30.744	60	137	IPR004333	Transcription factor, SBP-box
Gene3D	G3DSA:4.10.1100.10	1.3E-31	61	124	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.31E-37	62	141	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.1E-31	63	136	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
MEGQRSQRWG YLKDKAIATS LAEEETENSM DGEEDDTGDE DKRKRVMERA RGPNTERVPL 60 RLCLVDRCTA NLSEAKQYYR RHKVCEVHAK ASSATVAGVK QRFCQQCSRF HELAEFDETK 120 RSCRRRLAGH NERRRKISGD SYGEGSGRRG VSLTQTQERN RIDMKLPMTN SPFKRPQIR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	8e-40	60	136	8	84	squamosa promoter binding protein-like 4
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:14573523}.
Uniprot	TISSUE SPECIFICITY: Expressed in the inflorescence apical meristem and young flowers. {ECO:0000269\|PubMed:10524240}.

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:16914499}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00104877001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269\|PubMed:16914499}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ011610	1e-164	AJ011610.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 5.
GenBank	AJ242960	1e-164	AJ242960.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 5, (SPL5 gene).
GenBank	AK118611	1e-164	AK118611.1 Arabidopsis thaliana At3g15270 mRNA for squamosa promoter binding protein-like 5, putative, complete cds, clone: RAFL19-86-N19.
GenBank	BT003714	1e-164	BT003714.1 Arabidopsis thaliana At3g15270 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009146272.1	1e-131	PREDICTED: squamosa promoter-binding-like protein 5
Swissprot	Q9S758	6e-98	SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBL	A0A397ZH73	1e-130	A0A397ZH73_BRACM; Uncharacterized protein
TrEMBL	M4EEQ3	1e-130	M4EEQ3_BRARP; Uncharacterized protein
STRING	Bra027265.1-P	1e-131	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM868	28	118

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G15270.1	1e-100	squamosa promoter binding protein-like 5

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] Ioannidi E, et al. Trichome patterning control involves TTG1 interaction with SPL transcription factors. Plant Mol. Biol., 2016. 92(6): p. 675-687 [PMID:27631431] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142]