PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00102750001

Common Name

GSBRNA2T00102750001, LOC106357276

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

ZF-HD

Protein Properties

Length: 95aa MW: 10347.7 Da PI: 8.7013

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00102750001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	107.1	1.1e-33	28	84	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 ++rY eC+kNhAa++Gg+a+DGC+Efm+s g+egt++al+CaACgCHRnFHR+ev++e GSBRNA2T00102750001 28 NIRYVECQKNHAANIGGYAIDGCREFMAS-GNEGTVEALRCAACGCHRNFHRKEVNTE 84 78************************9.999*******************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	3.0E-32	2	93	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	3.5E-30	29	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	9.0E-29	30	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.819	31	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
MKRQMVIKQK SRKSNTSSCT TTSSAISNIR YVECQKNHAA NIGGYAIDGC REFMASGNEG 60 TVEALRCAAC GCHRNFHRKE VNTEVVCEYS PPNA*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in roots and stems, present in siliques and seedlings, and weakly observed in petioles, leaves and flowers. {ECO:0000269\|PubMed:16412086}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:16412086, ECO:0000269\|PubMed:21059647, ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00102750001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC011765	1e-73	AC011765.6 Arabidopsis thaliana chromosome 1 BAC F1M20 genomic sequence, complete sequence.
GenBank	AY085327	1e-73	AY085327.1 Arabidopsis thaliana clone 14583 mRNA, complete sequence.
GenBank	BT024806	1e-73	BT024806.1 Arabidopsis thaliana At1g74660 gene, complete cds.
GenBank	CP002684	1e-73	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009106129.1	1e-64	PREDICTED: mini zinc finger protein 1-like
Refseq	XP_013652413.1	1e-64	mini zinc finger protein 1
Swissprot	Q9CA51	2e-46	MIF1_ARATH; Mini zinc finger protein 1
TrEMBL	M4DHC1	2e-63	M4DHC1_BRARP; Uncharacterized protein
STRING	Bra015898.1-P	4e-64	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74660.1	7e-45	mini zinc finger 1

Link Out ? help Back to Top
Entrez Gene	106357276

Publications ? help Back to Top
Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293]