PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00099428001
Common NameGSBRNA2T00099428001, GSBRNA2T00143637001, LOC106386349, LOC106449646
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ZF-HD
Protein Properties Length: 98aa    MW: 10648.8 Da    PI: 8.6128
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00099428001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.33.7e-333087260
          ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                         +++rY eC+kNhAa++Gg+avDGC+Efm++ g egt ++l+CaACgCHRnFHR+ev++e
  GSBRNA2T00099428001 30 SSIRYVECQKNHAANIGGYAVDGCREFMAA-GVEGTDDSLRCAACGCHRNFHRKEVNTE 87
                         5789*************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-32196IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.0E-303284IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.0E-273384IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.1513483IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MKKRQVVIKQ RSRNSNTSSS WTTTSSSATS SIRYVECQKN HAANIGGYAV DGCREFMAAG  60
VEGTDDSLRC AACGCHRNFH RKEVNTEVVC EYSPPNA*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in roots and stems, present in siliques and seedlings, and weakly observed in petioles, leaves and flowers. {ECO:0000269|PubMed:16412086}.
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00099428001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896051e-161AC189605.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH015N11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104753.11e-67PREDICTED: mini zinc finger protein 1
RefseqXP_013590846.11e-67PREDICTED: mini zinc finger protein 1
RefseqXP_013681656.11e-67mini zinc finger protein 1
RefseqXP_013746836.11e-67mini zinc finger protein 1
SwissprotQ9CA512e-47MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A0D3CWM73e-66A0A0D3CWM7_BRAOL; Uncharacterized protein
TrEMBLA0A397YNX83e-66A0A397YNX8_BRACM; Uncharacterized protein
TrEMBLA0A3P6GU813e-66A0A3P6GU81_BRAOL; Uncharacterized protein
TrEMBLM4CHV83e-66M4CHV8_BRARP; Uncharacterized protein
STRINGBra003791.1-P5e-67(Brassica rapa)
STRINGBo6g086900.15e-67(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.12e-45mini zinc finger 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]