PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00077584001 | ||||||||
Common Name | GSBRNA2T00077584001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 102aa MW: 11227.3 Da PI: 10.8287 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.7 | 3.2e-18 | 33 | 66 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 Cs C+ttkTp+WR gp+g+k+LCnaCG++ k++ GSBRNA2T00077584001 33 CSECKTTKTPMWRGGPSGPKSLCNACGIRLMKQR 66 ****************************988876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 6.65E-14 | 26 | 67 | No hit | No description |
SMART | SM00401 | 5.3E-16 | 27 | 83 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 11.991 | 27 | 60 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 1.8E-15 | 31 | 67 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.21E-9 | 33 | 67 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 33 | 58 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 5.9E-16 | 33 | 66 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MLYKNIQRFL ATVVSKGALI TKMEEEKKTV RCCSECKTTK TPMWRGGPSG PKSLCNACGI 60 RLMKQRRSEL LGIRIIHSHK AYKKINSSPS SLSFSHGGVS L* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00077584001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493761 | 2e-44 | AB493761.1 Arabidopsis thaliana At5g26930 mRNA for hypothetical protein, partial cds, clone: RAAt5g26930. | |||
GenBank | AY086778 | 2e-44 | AY086778.1 Arabidopsis thaliana clone 27625 mRNA, complete sequence. | |||
GenBank | BT024789 | 2e-44 | BT024789.1 Arabidopsis thaliana At5g26930 gene, complete cds. | |||
GenBank | DQ446989 | 2e-44 | DQ446989.1 Arabidopsis thaliana clone pENTR221-At5g26930 zinc finger family protein (At5g26930) mRNA, complete cds. | |||
GenBank | DQ653310 | 2e-44 | DQ653310.1 Arabidopsis thaliana clone 0000012664_0000009184 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013597259.1 | 2e-46 | PREDICTED: GATA transcription factor 23-like | ||||
Swissprot | Q8LC59 | 4e-35 | GAT23_ARATH; GATA transcription factor 23 | ||||
TrEMBL | A0A078JT08 | 1e-67 | A0A078JT08_BRANA; BnaAnng28230D protein | ||||
STRING | Bra009926.1-P | 2e-51 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14484 | 16 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 1e-34 | GATA transcription factor 23 |
Publications ? help Back to Top | |||
---|---|---|---|
|