PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00068515001 | ||||||||
Common Name | GSBRNA2T00068515001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 177aa MW: 20513.2 Da PI: 8.6209 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 102.7 | 2.1e-32 | 94 | 152 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dpk++++tYeg Hnh+ GSBRNA2T00068515001 94 LDDGYRWRKYGQKSVKNNGHPRSYYRCTYHTCNVKKQVQRLAKDPKIIVTTYEGIHNHP 152 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.2E-32 | 81 | 152 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-28 | 86 | 153 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.402 | 89 | 154 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.0E-37 | 94 | 153 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.9E-26 | 95 | 152 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MERQDIIPHT LSLDVENNNN TFSSFVDETL MMMPPLALPG QVEPSSSSWC PTSFHMPTQP 60 HENDQIGDHG KKKDKRSRKV PRIEFHTRSD DDVLDDGYRW RKYGQKSVKN NGHPRSYYRC 120 TYHTCNVKKQ VQRLAKDPKI IVTTYEGIHN HPCEKLMETL NPLLRQLQFL SSFSNL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-26 | 85 | 151 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-26 | 85 | 151 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00068515001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF430042 | 0.0 | KF430042.1 Brassica rapa WRKY transcription factor 24 (WRKY24) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009140098.1 | 1e-130 | PREDICTED: probable WRKY transcription factor 24 | ||||
Swissprot | Q9FFS3 | 1e-97 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | A0A078HPF0 | 1e-130 | A0A078HPF0_BRANA; BnaA04g11210D protein | ||||
STRING | Bra025490.1-P | 1e-129 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 4e-89 | WRKY DNA-binding protein 24 |
Publications ? help Back to Top | |||
---|---|---|---|
|