 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
GSBRNA2T00059332001 |
| Common Name | GSBRNA2T00059332001 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
| Family |
MIKC_MADS |
| Protein Properties |
Length: 155aa MW: 17590.4 Da PI: 9.1766 |
| Description |
MIKC_MADS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| GSBRNA2T00059332001 | genome | Genoscope | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 79.4 | 2.5e-25 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien nr vtfskRrng+ KKA+E+ vLCda+va+i+f+s+gk+ +y+
GSBRNA2T00059332001 9 KRIENVNNRVVTFSKRRNGLVKKAKEITVLCDAKVALIVFASNGKMTDYC 58
79*********************************************997 PP
|
| 2 | K-box | 72.2 | 1.6e-24 | 71 | 139 | 1 | 69 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69
yqk sgk+l++ak+e+l++e++k+kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+++e++l k+R+++
GSBRNA2T00059332001 71 YQKLSGKKLWDAKHENLSNEIDKIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAVEHGLDKVRDHQ 139
899***************************************************************986 PP
|
| Protein Features
? help Back to Top |
 |
| Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
| SMART | SM00432 | 6.0E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.151 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.67E-37 | 2 | 80 | No hit | No description |
| SuperFamily | SSF55455 | 7.46E-34 | 2 | 96 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.0E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.3E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.0E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.0E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 4.4E-15 | 82 | 139 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 10.236 | 84 | 154 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0046983 | Molecular Function | protein dimerization activity |
| Sequence ? help Back to Top |
| Protein Sequence Length: 155 aa
Download sequence Send
to blast |
MGRGKIEIKR IENVNNRVVT FSKRRNGLVK KAKEITVLCD AKVALIVFAS NGKMTDYCCP 60
SMDLGAMLDQ YQKLSGKKLW DAKHENLSNE IDKIKKENDS LQLELRHLKG EDIQSLNLKN 120
LMAVEHAVEH GLDKVRDHQA YGVPYDKKEK CDHI*
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with APETALA3 that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269|PubMed:18417639, ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9489703}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:11283333, ECO:0000269|PubMed:19783648}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | KC967963 | 0.0 | KC967963.1 Brassica oleracea var. viridis PI.c (PI.c) mRNA, complete cds. |
| Publications
? help Back to Top |
- Zhang Y, et al.
A cucumber DELLA homolog CsGAIP may inhibit staminate development through transcriptional repression of B class floral homeotic genes.
PLoS ONE, 2014. 9(3): p. e91804
[PMID:24632777] - Chalhoub B, et al.
Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
Science, 2014. 345(6199): p. 950-3
[PMID:25146293] - Jing D, et al.
Ectopic expression of a Catalpa bungei (Bignoniaceae) PISTILLATA homologue rescues the petal and stamen identities in Arabidopsis pi-1 mutant.
Plant Sci., 2015. 231: p. 40-51
[PMID:25575990] - Behrend A,Borchert T,Hohe A
"The usual suspects"- analysis of transcriptome sequences reveals deviating B gene activity in C. vulgaris bud bloomers.
BMC Plant Biol., 2015. 15: p. 8
[PMID:25604890] - Morroll SM,Wilson ZA
Arabidopsis YAC restriction mapping.
Genome, 1998. 41(6): p. 806-17
[PMID:9924791]
|
