PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00057987001 | ||||||||
Common Name | GSBRNA2T00057987001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 81aa MW: 9233.25 Da PI: 4.1051 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 31.1 | 4.2e-10 | 2 | 45 | 53 | 98 |
EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 53 rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 +k++++++lt GW++Fvk+n+L++g ++ F +d +++f +v +f GSBRNA2T00057987001 2 KKRGETVFLTVGWENFVKDNELEDGKMMEFIYDCDRTF--YVVIFG 45 577788*************************9987777..888876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 10.856 | 1 | 47 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 3.7E-9 | 2 | 46 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 2.16E-10 | 2 | 47 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 1.6E-7 | 2 | 45 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
MKKRGETVFL TVGWENFVKD NELEDGKMME FIYDCDRTFY VVIFGHGGVS ELRVFPQAVV 60 DVGDYATGEE EEEEEKNKSN * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1yel_A | 2e-22 | 1 | 46 | 56 | 101 | At1g16640 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00057987001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009149100.1 | 2e-52 | PREDICTED: B3 domain-containing protein At1g16640 | ||||
Refseq | XP_013646622.1 | 2e-52 | B3 domain-containing protein At1g16640-like | ||||
Swissprot | Q9FX77 | 2e-27 | Y1664_ARATH; B3 domain-containing protein At1g16640 | ||||
TrEMBL | A0A397YYT1 | 5e-51 | A0A397YYT1_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3P5YQI8 | 5e-51 | A0A3P5YQI8_BRACM; Uncharacterized protein | ||||
STRING | Bra026034.1-P | 9e-52 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15751 | 14 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16640.1 | 8e-30 | B3 family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|