PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00057568001 | ||||||||
Common Name | GSBRNA2T00057568001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 172aa MW: 18435.9 Da PI: 8.9537 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 55.6 | 7.3e-18 | 40 | 74 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ Cgt kTplWR gp g+k+LCn CG++ rkk++ GSBRNA2T00057568001 40 CVDCGTFKTPLWRGGPAGPKSLCNDCGIKSRKKRQ 74 *********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 11.055 | 34 | 70 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 2.3E-11 | 34 | 85 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 9.5E-12 | 35 | 77 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 2.6E-13 | 38 | 74 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 3.02E-11 | 39 | 87 | No hit | No description |
Pfam | PF00320 | 1.2E-15 | 40 | 74 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MSEGSEETKT KVDSAGELSD VDNENCSSSG SGGGETKKTC VDCGTFKTPL WRGGPAGPKS 60 LCNDCGIKSR KKRQAALGIK PEKKIRKSNS CDSDLSLEDD RNVNNKIKKA DDHTSTSSSC 120 SKRVSKFLDL GLEVPVMKRS AVEKKRLWKK LGEEERAAVL LMALSCGSVY A* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00057568001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189317 | 2e-86 | AC189317.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB036B21, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009114215.1 | 1e-109 | PREDICTED: GATA transcription factor 17-like | ||||
Swissprot | Q9LIB5 | 1e-71 | GAT17_ARATH; GATA transcription factor 17 | ||||
TrEMBL | A0A078HB79 | 1e-118 | A0A078HB79_BRANA; BnaA01g27530D protein | ||||
TrEMBL | A0A398ARL2 | 1e-118 | A0A398ARL2_BRACM; Uncharacterized protein | ||||
STRING | Bra021209.1-P | 1e-109 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12643 | 15 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G16870.1 | 4e-73 | GATA transcription factor 17 |
Publications ? help Back to Top | |||
---|---|---|---|
|