![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00034374001 | ||||||||
Common Name | GSBRNA2T00034374001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | CAMTA | ||||||||
Protein Properties | Length: 113aa MW: 13420.2 Da PI: 6.7923 | ||||||||
Description | CAMTA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CG-1 | 126.5 | 1.1e-39 | 34 | 111 | 41 | 118 |
CG-1 41 LynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118 L + +++ryfrkDG++w++kkdgktv+E+hekLKvg+++vl+cyYah e+n++fqrrcyw+Le+el ++v+++ylevk GSBRNA2T00034374001 34 LHSFQVLRYFRKDGHNWRNKKDGKTVKEAHEKLKVGSIDVLHCYYAHEEDNENFQRRCYWMLEQELMHVVFIQYLEVK 111 556689*********************************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51437 | 49.742 | 1 | 112 | IPR005559 | CG-1 DNA-binding domain |
SMART | SM01076 | 6.5E-36 | 5 | 111 | IPR005559 | CG-1 DNA-binding domain |
Pfam | PF03859 | 1.0E-32 | 36 | 110 | IPR005559 | CG-1 DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MVDVLRTPSS DSSLLIRFND STDFDELTKP VSPLHSFQVL RYFRKDGHNW RNKKDGKTVK 60 EAHEKLKVGS IDVLHCYYAH EEDNENFQRR CYWMLEQELM HVVFIQYLEV KV* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, old leaves, petals, sepals, top of carpels, stigmas, stamen filaments, anthers and siliques, but not in pollen. {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:14581622}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25627216, ECO:0000305|PubMed:11925432}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00034374001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:25627216}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493811 | 1e-70 | AB493811.1 Arabidopsis thaliana At5g64220 mRNA for hypothetical protein, partial cds, clone: RAAt5g64220. | |||
GenBank | AK229403 | 1e-70 | AK229403.1 Arabidopsis thaliana mRNA for Calmodulin-binding transcription activator 2, complete cds, clone: RAFL16-66-C08. | |||
GenBank | BT010874 | 1e-70 | BT010874.1 Arabidopsis thaliana At5g64220 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013616703.1 | 8e-52 | PREDICTED: uncharacterized protein LOC106323081 isoform X2 | ||||
Swissprot | Q6NPP4 | 4e-44 | CMTA2_ARATH; Calmodulin-binding transcription activator 2 | ||||
TrEMBL | A0A078JC46 | 1e-78 | A0A078JC46_BRANA; BnaC02g46140D protein | ||||
STRING | XP_010444355.1 | 1e-42 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM19280 | 4 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64220.2 | 2e-46 | Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains |
Publications ? help Back to Top | |||
---|---|---|---|
|