PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00032812001 | ||||||||
Common Name | GSBRNA2T00032812001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 189aa MW: 21110.6 Da PI: 6.946 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.5 | 1.2e-32 | 106 | 164 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dpkvv++tYeg Hnh+ GSBRNA2T00032812001 106 LDDGYRWRKYGQKSVKNNAHPRSYYRCTYHTCNVKKQVQRLAKDPKVVVTTYEGVHNHP 164 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.3E-33 | 93 | 164 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.35E-28 | 98 | 165 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.746 | 101 | 166 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.0E-38 | 106 | 165 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.2E-26 | 107 | 164 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MEGVDDTNPT LTLEEGENNP FSSFDKTLMM MDPSLMFSSD MGASSSCSPA SFHMSAQPEN 60 FQHAEGGDAV EIGGLSDHNK NSKGKGKISS AMQRIAFHTR SDDDVLDDGY RWRKYGQKSV 120 KNNAHPRSYY RCTYHTCNVK KQVQRLAKDP KVVVTTYEGV HNHPCEKLME TLSPLLRQLQ 180 FLTRVSDL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-27 | 96 | 163 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-27 | 96 | 163 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00032812001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM593163 | 0.0 | KM593163.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY115) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013673870.1 | 1e-140 | probable WRKY transcription factor 56 | ||||
Refseq | XP_013691492.1 | 1e-140 | probable WRKY transcription factor 56 | ||||
Swissprot | Q8VWQ4 | 1e-102 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | A0A078GJZ7 | 1e-141 | A0A078GJZ7_BRANA; BnaC09g11790D protein | ||||
STRING | Bo9g030630.1 | 1e-139 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 2e-99 | WRKY DNA-binding protein 56 |
Publications ? help Back to Top | |||
---|---|---|---|
|