PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00031185001 | ||||||||
Common Name | GSBRNA2T00031185001, LOC106407676 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 184aa MW: 20802.3 Da PI: 9.3061 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 107.4 | 1.2e-33 | 100 | 156 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rakle+++k+ ksrkpylheSRh hA+rRpRg+gGrF GSBRNA2T00031185001 100 EEPVFVNAKQYHGILRRRQSRAKLESQNKV-VKSRKPYLHESRHLHAIRRPRGCGGRF 156 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.2E-38 | 98 | 159 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.642 | 99 | 159 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.8E-28 | 101 | 156 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.1E-24 | 102 | 124 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 104 | 124 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.1E-24 | 133 | 156 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MASSVHDLSD KIETHDKQEH KDFQFQIQPP IPPGRNSAVY SEQLPHSMAP GHYPYPDPHY 60 RSIFAPNPQA YPPRPYETGV HAHLMGVQQQ CVPLPSDAVE EPVFVNAKQY HGILRRRQSR 120 AKLESQNKVV KSRKPYLHES RHLHAIRRPR GCGGRFLNAK KEEEHHEGNH VEEKSMAASG 180 GTS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-21 | 99 | 166 | 1 | 68 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00031185001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189342 | 4e-87 | AC189342.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042D24, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013703999.1 | 1e-134 | nuclear transcription factor Y subunit A-7 | ||||
Refseq | XP_013704000.1 | 1e-134 | nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q84JP1 | 5e-89 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A078F8C3 | 1e-132 | A0A078F8C3_BRANA; BnaC05g23480D protein | ||||
TrEMBL | A0A3P6EHX4 | 1e-132 | A0A3P6EHX4_BRAOL; Uncharacterized protein | ||||
STRING | Bo5g063060.1 | 1e-131 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4168 | 27 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 7e-76 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106407676 |
Publications ? help Back to Top | |||
---|---|---|---|
|