![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00011094001 | ||||||||
Common Name | GSBRNA2T00011094001, LOC106454798 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 249aa MW: 28248.8 Da PI: 9.6964 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 164.7 | 3.4e-51 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrFhPtdeelvv+yLk+kv +++l++ ++i++vd+++++PwdLp + eke yfFs+r+ ky++g+r+nra++sgyWkatg dk GSBRNA2T00011094001 14 LPPGFRFHPTDEELVVQYLKRKVFSSPLPA-SIIPDVDVCRADPWDLPGN---LEKERYFFSTREAKYPNGNRSNRAAESGYWKATGIDK 99 79****************************.89***************44...4789********************************9 PP NAM 91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 +v+++ +++ vglkktLvfy+g+ p+g++tdW+mheyrl GSBRNA2T00011094001 100 RVVTSrGNQIVGLKKTLVFYRGKPPHGSRTDWIMHEYRL 138 9998857777***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.53E-60 | 10 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 58.774 | 14 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.4E-27 | 15 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MDKTNLAKNG VLRLPPGFRF HPTDEELVVQ YLKRKVFSSP LPASIIPDVD VCRADPWDLP 60 GNLEKERYFF STREAKYPNG NRSNRAAESG YWKATGIDKR VVTSRGNQIV GLKKTLVFYR 120 GKPPHGSRTD WIMHEYRLSS SPPSSIGPTQ NWVLCRIFLK KRAGDKNEDE GDSRNLRYNN 180 DQLEIITTNQ TEDKTKPIFF DFMRKERTTD LNLLPSSPSS GHASSGVTME IFSSDEETSS 240 CNSLRRNL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-51 | 12 | 166 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-51 | 12 | 166 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-51 | 12 | 166 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-51 | 12 | 166 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swm_B | 2e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swm_C | 2e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swm_D | 2e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swp_A | 2e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swp_B | 2e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swp_C | 2e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swp_D | 2e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
4dul_A | 2e-51 | 12 | 166 | 15 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-51 | 12 | 166 | 15 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.7458 | 0.0 | flower| leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00011094001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK352817 | 0.0 | AK352817.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-04-E01. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013752356.1 | 0.0 | NAC domain-containing protein 83 | ||||
Swissprot | Q9FY93 | 1e-144 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A078IRF0 | 0.0 | A0A078IRF0_BRANA; BnaC03g71470D protein | ||||
STRING | Bo3g009040.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1806 | 27 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 1e-143 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106454798 |
Publications ? help Back to Top | |||
---|---|---|---|
|