PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00009956001

Common Name

GSBRNA2T00009956001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NAC

Protein Properties

Length: 304aa MW: 33951.5 Da PI: 7.4928

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00009956001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	174.5	3.2e-54	21	148	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 +ppGfrFhPtdeel+++yL kkv ++++++ +i++vd++k+ePw+Lp+k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkd+ GSBRNA2T00009956001 21 MPPGFRFHPTDEELITYYLLKKVLDSSFTC-AAISQVDLNKSEPWELPEKAKLGEKEWYFFTLRDRKYPTGLRTNRATEAGYWKATGKDR 109 79************************99.88***********99999********************************* PP NAM 91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 e++s+ +++l g+kktLvfykgrapkgek+ Wvmheyrl GSBRNA2T00009956001 110 EIKSSkTKSLLGMKKTLVFYKGRAPKGEKSCWVMHEYRL 148 9856677**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.05E-60	15	173	IPR003441	NAC domain
PROSITE profile	PS51005	57.37	21	173	IPR003441	NAC domain
Pfam	PF02365	1.1E-28	22	148	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 304 aa Download sequence Send to blast
MDMDVFSGWE RSSRYEDETI MPPGFRFHPT DEELITYYLL KKVLDSSFTC AAISQVDLNK 60 SEPWELPEKA KLGEKEWYFF TLRDRKYPTG LRTNRATEAG YWKATGKDRE IKSSKTKSLL 120 GMKKTLVFYK GRAPKGEKSC WVMHEYRLDG KFSYQYLTSS VKDEWVLSKV SLKSSVVVGR 180 EQTKLLSSST ASVAGEVSSS APIIDAFATE HVSCFSNTSA AAHADTSFPT YLPAPPLSLP 240 RQPRRIGGDD VAFGQFMDMG SSGQFNVDEA ATFLPYLPPT VLHPPQTFEL YGGSALSCWP 300 FAL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-48	21	175	17	167	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-48	21	175	17	167	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-48	21	175	17	167	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-48	21	175	17	167	NO APICAL MERISTEM PROTEIN
3swm_A	1e-48	21	175	20	170	NAC domain-containing protein 19
3swm_B	1e-48	21	175	20	170	NAC domain-containing protein 19
3swm_C	1e-48	21	175	20	170	NAC domain-containing protein 19
3swm_D	1e-48	21	175	20	170	NAC domain-containing protein 19
3swp_A	1e-48	21	175	20	170	NAC domain-containing protein 19
3swp_B	1e-48	21	175	20	170	NAC domain-containing protein 19
3swp_C	1e-48	21	175	20	170	NAC domain-containing protein 19
3swp_D	1e-48	21	175	20	170	NAC domain-containing protein 19
3ulx_A	1e-48	8	175	2	170	Stress-induced transcription factor NAC1
4dul_A	1e-48	21	175	17	167	NAC domain-containing protein 19
4dul_B	1e-48	21	175	17	167	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.1128	0.0	flower

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First observed in young embryonic SAM. Later confined to the boundaries between cotyledon primordia and the SAM. In mature embryos, localized around first leaves primordia. Only weakly present in vegetative SAM. In inflorescence, observed at the boundaries between floral organ primordia. In callus, expressed during transition to shoot development, with a progressive restriction to specific areas corresponding to future shoot apex. {ECO:0000269\|PubMed:11245578, ECO:0000269\|PubMed:12492830}.
Uniprot	TISSUE SPECIFICITY: Expressed in inflorescence stems, rosette leaves, aerial parts of seedlings, flowers, floral buds and roots. {ECO:0000269\|PubMed:11245578}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:10750709, ECO:0000269\|PubMed:11245578, ECO:0000269\|PubMed:12163400, ECO:0000269\|PubMed:12492830, ECO:0000269\|PubMed:12610213, ECO:0000269\|PubMed:12787253, ECO:0000269\|PubMed:14617069, ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15500463, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16798887, ECO:0000269\|PubMed:17122068, ECO:0000269\|PubMed:17287247, ECO:0000269\|PubMed:9212461}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00009956001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16854978, ECO:0000269\|PubMed:17056621, ECO:0000269\|PubMed:17287247}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC966754	0.0	KC966754.1 Brassica napus NAC transcription factor 54-1 (NAC54-1.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009116467.1	0.0	PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
Swissprot	Q9FRV4	1e-145	NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBL	A0A078G643	0.0	A0A078G643_BRANA; BnaA01g28990D protein
TrEMBL	M4DYJ6	0.0	M4DYJ6_BRARP; Uncharacterized protein
STRING	Bra021592.1-P	0.0	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM13481	15	28

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G15170.1	1e-139	NAC family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Shinohara N,Ohbayashi I,Sugiyama M Involvement of rRNA biosynthesis in the regulation of CUC1 gene expression and pre-meristematic cell mound formation during shoot regeneration. Front Plant Sci, 2014. 5: p. 159 [PMID:24808900] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Cui X, et al. REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] González-Carranza ZH, et al. HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292]