PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

MYB

Protein Properties

Length: 273aa MW: 29044.5 Da PI: 8.9488

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G701063_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.4	2.9e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed+ l+ +vk +G g W+ ++++ g++R++k+c++rw++yl GRMZM2G701063_P01 14 RGAWTAKEDDTLAAYVKAHGEGKWREVPQKAGLRRCGKSCRLRWLNYL 61 89********************************************97 PP
2	Myb_DNA-binding	48.7	1.7e-15	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + +E++l+v+++k+lG++ W++Ia +++ gRt++++k++w++ GRMZM2G701063_P01 67 RGNISYDEEDLIVRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 111 788899**************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.4E-23	6	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.209	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	7.03E-29	11	108	IPR009057	Homeodomain-like
SMART	SM00717	5.4E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.08E-9	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.9E-22	65	114	IPR009057	Homeodomain-like
SMART	SM00717	3.9E-13	66	114	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	18.371	66	116	IPR017930	Myb domain
Pfam	PF00249	1.8E-13	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	1.34E-10	73	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0090379	Biological Process	secondary cell wall biogenesis involved in seed trichome differentiation
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 273 aa Download sequence Send to blast
MGRRACCAKE GVKRGAWTAK EDDTLAAYVK AHGEGKWREV PQKAGLRRCG KSCRLRWLNY 60 LRPNIKRGNI SYDEEDLIVR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNS TLGRRAGAGA 120 GAGGSRVVFA PDTGSHATPA AAGSREMTGG QKGAAPRADL GSPGSAAVVW APKAARCTGG 180 LFFHRRDTHT PHAGGTETPT PMMAGGAGGE ARSSDDCSSA ASVSVSPLVG SSQHDPCFSG 240 DGNGDWMDDV RALASFLESD EEWLRCHTAE QLV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-24	14	116	7	108	B-MYB
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G701063

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G701063_P01

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY135018	0.0	AY135018.1 Zea mays PL transcription factor (pl) mRNA, pl-bol3 allele, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008648335.1	1e-175	PL transcription factor isoform X1
Swissprot	P10290	1e-116	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	Q6QP46	0.0	Q6QP46_MAIZE; Anthocyanin biosynthesis regulatory protein Pl1_B73
STRING	GRMZM2G701063_P01	0.0	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13540.1	2e-56	myb domain protein 5

Link Out ? help Back to Top
Phytozome	GRMZM2G701063_P01

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Swigonov Close split of sorghum and maize genome progenitors. Genome Res., 2004. 14(10A): p. 1916-23 [PMID:15466289] Lai J, et al. Gene loss and movement in the maize genome. Genome Res., 2004. 14(10A): p. 1924-31 [PMID:15466290] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]