![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G370332_P02 | ||||||||
Common Name | LOC100383874 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 310aa MW: 33792 Da PI: 6.1854 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 22.7 | 1.7e-07 | 250 | 283 | 21 | 54 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 k +yp+++++++L +++gL+ +q+ +WF N+R + GRMZM2G370332_P02 250 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 283 569*****************************87 PP | |||||||
2 | ELK | 28.1 | 4.6e-10 | 204 | 225 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++L+++Y+++L+++++E++ GRMZM2G370332_P02 204 ELKNELKQGYKEKLVDIREEIM 225 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01255 | 1.6E-19 | 39 | 83 | IPR005540 | KNOX1 |
Pfam | PF03790 | 1.5E-16 | 42 | 79 | IPR005540 | KNOX1 |
SMART | SM01256 | 6.2E-26 | 93 | 148 | IPR005541 | KNOX2 |
Pfam | PF03791 | 4.6E-16 | 101 | 147 | IPR005541 | KNOX2 |
Pfam | PF03789 | 6.9E-7 | 204 | 225 | IPR005539 | ELK domain |
SMART | SM01188 | 6.3E-4 | 204 | 225 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 10.057 | 204 | 224 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 11.548 | 224 | 287 | IPR001356 | Homeobox domain |
SMART | SM00389 | 2.8E-10 | 226 | 291 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 9.84E-16 | 226 | 289 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.40E-11 | 227 | 288 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.5E-24 | 231 | 288 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 8.5E-18 | 244 | 283 | IPR008422 | Homeobox KN domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0009722 | Biological Process | detection of cytokinin stimulus | ||||
GO:0071345 | Biological Process | cellular response to cytokine stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005829 | Cellular Component | cytosol | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0004006 | anatomy | mesophyll cell | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0025589 | anatomy | leaf lamina tip | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 310 aa Download sequence Send to blast |
MSFHYPDHGL SMDAAAAAAA AAAASSPNPS GFSPGVGGER EKAAIAAHPL YERLLEAHVA 60 CLRVATPVDQ LPRIDAQIAA RPPPLAAAAG AAAAGGPSGG EELDLFMTHY VLLLCSFKEQ 120 LQQHVRVHAM EAVMGCWELE QSLQSLTGAS PGEGTGATMS DDEDNQVDSE ANMFDGNDGS 180 DGMGFGPLML TEGERSLVER VRQELKNELK QGYKEKLVDI REEIMRKRRA GKLPGDTASV 240 LKAWWQAHSK WPYPTEDDKA RLVQETGLQL KQINNWFINQ RKRNWHSNPT SSGEKTKKKR 300 YHNESCFAVA |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 280 | 299 | RKRNWHSNPTSSGEKTKKKR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.68135 | 0.0 | ear| leaf| meristem| ovary| pedicel| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G370332 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Isoform 1 is expressed in roots, leaf blades, leaf sheaths and flowers. Isoform 2 is expressed in leaf blades, leaf sheaths and flowers. {ECO:0000269|PubMed:12034492}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G370332_P02 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT068510 | 0.0 | BT068510.1 Zea mays full-length cDNA clone ZM_BFb0231A20 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001169973.1 | 0.0 | putative knotted-like transcription factor family protein | ||||
Swissprot | Q0E3C3 | 0.0 | KNOS2_ORYSJ; Homeobox protein knotted-1-like 2 | ||||
TrEMBL | A0A3L6ELG0 | 0.0 | A0A3L6ELG0_MAIZE; Homeobox protein knotted-1-like 2 | ||||
TrEMBL | C0PJP1 | 0.0 | C0PJP1_MAIZE; Knotted related homeobox6 | ||||
STRING | GRMZM2G370332_P02 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP564 | 38 | 169 |
Representative plant | OGRP167 | 17 | 148 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G25220.2 | 1e-144 | KNOTTED1-like homeobox gene 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G370332_P02 |