![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G346920_P01 | ||||||||
Common Name | cl50557_1, Zm.14128 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 308aa MW: 31556.2 Da PI: 7.0896 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 102.4 | 2.9e-32 | 76 | 130 | 4 | 59 |
ZF-HD_dimer 4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 +rY+eClkNhA+ +GghavDGCgEfm++ geeg+++al+CaACgCHRnFHR+e+++ GRMZM2G346920_P01 76 TRYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGSIDALRCAACGCHRNFHRKESDN 130 79*************************9.999********************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 3.5E-29 | 76 | 128 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 3.0E-24 | 77 | 130 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 8.9E-30 | 77 | 127 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 27.963 | 78 | 127 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
SuperFamily | SSF46689 | 1.51E-20 | 232 | 306 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.3E-32 | 235 | 307 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01565 | 2.5E-25 | 245 | 301 | IPR006455 | Homeodomain, ZF-HD class |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 308 aa Download sequence Send to blast |
MDFDEHDDGD EEMTPMPVSS SYDAPMQPGL GLGGGGGETP KHGDSAGAGS FRTPPAGGFG 60 GGGAGAGAGA GGGGATRYRE CLKNHAVGIG GHAVDGCGEF MAAGEEGSID ALRCAACGCH 120 RNFHRKESDN SPAGGGGVAP PDPAAALSPA AITAYGAAVA AHHHQFSPYY RTPAGYFLHQ 180 QLAAAAGHMQ RPLALPSTSH SLGREEGDDV SGLIGPMVVA PMMGMSLGPG GGPSGGSSGG 240 SGSGKKRFRT KFTQEQKDRM LAFAERLGWR IQKHDEAAVQ QFCEEVCVKR HVLKVWMHNN 300 KHTLGKKP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wh7_A | 3e-28 | 246 | 303 | 18 | 75 | ZF-HD homeobox family protein |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.14128 | 0.0 | ear| meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G346920 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. {ECO:0000250}. | |||||
UniProt | Putative transcription factor. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G346920_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU963277 | 0.0 | EU963277.1 Zea mays clone 260287 ZF-HD protein dimerisation region containing protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001149424.2 | 0.0 | uncharacterized protein LOC100283050 | ||||
Swissprot | A2YWA6 | 1e-117 | ZHD2_ORYSI; Zinc-finger homeodomain protein 2 | ||||
Swissprot | Q6ZB90 | 1e-117 | ZHD2_ORYSJ; Zinc-finger homeodomain protein 2 | ||||
TrEMBL | A0A1D6KLI5 | 0.0 | A0A1D6KLI5_MAIZE; ZF-HD protein dimerization region containing protein | ||||
TrEMBL | A0A317YC70 | 0.0 | A0A317YC70_MAIZE; Zinc-finger homeodomain protein 2 | ||||
STRING | GRMZM2G346920_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3950 | 32 | 69 |
Representative plant | OGRP91 | 16 | 237 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14440.2 | 4e-51 | homeobox protein 31 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G346920_P01 |
Entrez Gene | 100283050 |
Publications ? help Back to Top | |||
---|---|---|---|
|