![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G168079_P01 | ||||||||
Common Name | ZEAMMB73_125662, Zm.18160 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 412aa MW: 43446.9 Da PI: 6.2769 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 43.1 | 9.5e-14 | 328 | 372 | 5 | 49 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 +r+rr++kNRe+A rsR+RK+a++ eLe + L++eN++L+ e GRMZM2G168079_P01 328 RRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENERLRAEE 372 79****************************************874 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.5E-13 | 324 | 390 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.243 | 326 | 371 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.13E-10 | 328 | 373 | No hit | No description |
Pfam | PF00170 | 2.5E-11 | 328 | 374 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 1.02E-22 | 328 | 369 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 4.9E-13 | 328 | 372 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 331 | 346 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009409 | Biological Process | response to cold | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 412 aa Download sequence Send to blast |
MASEMSKNVK ALDEQEVTSQ HSRAQTSDAA EEQQQQQQAV DPLARQSSIM SLTLEELQNS 60 LCEPGRNFGS MNMDEFMANI WNAEEFQAAT AGCNKEGAER EPVPVATTTG TGENGGGGGS 120 GRGLVRQGSF ALPPPLSRKT VEEVWAEISQ GPADFQASAA PQPVAQPQAA SGGGVAASGR 180 QATLGEMTLE DFLVKAGVVR GAFAGHGHGV GMVPAGPMGM QHNAAPPMMY QVAAAAAPPP 240 GAVYPVMGDG MGYHGGGYPG GVAVVPPPPP SQCVAAAASP GSSDGMSAMT QAEMMNCIGN 300 GGVVRNGGGG ARKRDFPEDG CTEKTVERRQ RRMIKNRESA ARSRARKQAY TVELEAELNH 360 LKEENERLRA EERTILLSKK KMLVEKMMEQ ARENVSAKKV GPGLRRWGSA MW |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.18160 | 0.0 | ovary |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G168079 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves and panicles (PubMed:17604002). Expressed in seeds (PubMed:21055780). {ECO:0000269|PubMed:17604002, ECO:0000269|PubMed:21055780}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that possesses transactivation activity in yeast (PubMed:17604002, PubMed:21055780, PubMed:18236009). Involved in abscisic acid (ABA) signaling pathway. Binds to the G-box motif 5'-CACGTG-3' of TRAB1 gene promoter (PubMed:17604002). Involved in the regulation of pollen maturation. May act as negative regulator of salt stress response (PubMed:18236009). Together with PYL5, PP2C30 and SAPK2, is part of an ABA signaling unit that modulates seed germination and early seedling growth (PubMed:22071266). {ECO:0000269|PubMed:17604002, ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G168079_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) (PubMed:21055780, PubMed:18236009, PubMed:22071266). Induced by salt stress. Down-regulated by cold and drought stresses (PubMed:18236009). {ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU971027 | 0.0 | EU971027.1 Zea mays clone 356068 ABA response element binding factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001151515.1 | 0.0 | ABA response element binding factor | ||||
Swissprot | Q8RZ35 | 1e-162 | ABI5_ORYSJ; bZIP transcription factor ABI5 homolog | ||||
TrEMBL | B6UI01 | 0.0 | B6UI01_MAIZE; ABA response element binding factor | ||||
STRING | GRMZM2G168079_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3830 | 35 | 58 | Representative plant | OGRP540 | 15 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G49720.2 | 3e-28 | abscisic acid responsive element-binding factor 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G168079_P01 |
Publications ? help Back to Top | |||
---|---|---|---|
|