PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G159397_P01
Common Namem6, MADS6, zmm6
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 240aa    MW: 27903.8 Da    PI: 8.9631
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G159397_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.5e-32959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss
  GRMZM2G159397_P01  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSS 59
                       79***********************************************96 PP
2K-box98.11.3e-32841768100
              K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                        + e+++ +s+++e+ kLk++++nLqr+qR+llGedLesL +keL++Le+qL++slk+iRs++++++++q+ elqkke++  e+nk+Lr++le
  GRMZM2G159397_P01  84 NRENEQLKSSRNEYLKLKARVDNLQRTQRNLLGEDLESLGIKELEHLEKQLDSSLKHIRSTRTQHMVDQLTELQKKEQMFCEANKCLRRRLE 175
                        4678899**********************************************************************************998 PP

              K-box 100 e 100
                        e
  GRMZM2G159397_P01 176 E 176
                        6 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.7E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.641161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-33289IPR002100Transcription factor, MADS-box
CDDcd002657.15E-44274No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-333859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-2586174IPR002487Transcription factor, K-box
PROSITE profilePS5129714.84890180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFSST  60
QSMPKTLEKY QKCSFAGPET ALQNRENEQL KSSRNEYLKL KARVDNLQRT QRNLLGEDLE  120
SLGIKELEHL EKQLDSSLKH IRSTRTQHMV DQLTELQKKE QMFCEANKCL RRRLEESNQV  180
IWQHAWEQSE RHSEVQPQQL NGNNFFHPLD GAGEPTLQIG YPSEALTSSC MTTFLPPWLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A1e-30751761103Developmental protein SEPALLATA 3
4ox0_B1e-30751761103Developmental protein SEPALLATA 3
4ox0_C1e-30751761103Developmental protein SEPALLATA 3
4ox0_D1e-30751761103Developmental protein SEPALLATA 3
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G159397
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) primordia and later in stamen and pistil primordia. Expressed during ovule development in the inner and outer integuments. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:9065695}.
UniprotTISSUE SPECIFICITY: Expressed in lodicules, stamens and carpels. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:9065695, ECO:0000269|PubMed:9339904}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.10}.
Function -- GeneRIF ? help Back to Top
  1. These results indicated that ZMM7-L might be a negative transcription factor responsive to abiotic stresses.
    [PMID: 22440334]
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G159397_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306920.0AJ430692.1 Zea mays mRNA for putative MADS-domain transcription factor (m6 gene).
GenBankBT0426050.0BT042605.1 Zea mays full-length cDNA clone ZM_BFb0367C04 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105153.11e-179MADS6
SwissprotP0C5B01e-144MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4661e-144MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLQ84V701e-178Q84V70_MAIZE; Developmental protein SEPALLATA 2
STRINGGRMZM2G159397_P011e-178(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34833469
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.15e-90MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Shitsukawa N, et al.
    Genetic and epigenetic alteration among three homoeologous genes of a class E MADS box gene in hexaploid wheat.
    Plant Cell, 2007. 19(6): p. 1723-37
    [PMID:17586655]
  3. Bai X,Wang Q,Chu C
    Excision of a selective marker in transgenic rice using a novel Cre/loxP system controlled by a floral specific promoter.
    Transgenic Res., 2008. 17(6): p. 1035-43
    [PMID:18437520]
  4. Qu L, et al.
    Expression pattern and functional analysis of a MADS-box gene M79 from rice.
    Sci. China, C, Life Sci., 2001. 44(2): p. 161-9
    [PMID:18726433]
  5. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  6. Cui R, et al.
    Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa).
    Plant J., 2010. 61(5): p. 767-81
    [PMID:20003164]
  7. Li H, et al.
    The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice.
    Cell Res., 2010. 20(3): p. 299-313
    [PMID:20038961]
  8. Seok HY, et al.
    Rice ternary MADS protein complexes containing class B MADS heterodimer.
    Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
    [PMID:20888318]
  9. Tang X, et al.
    Global gene profiling of laser-captured pollen mother cells indicates molecular pathways and gene subfamilies involved in rice meiosis.
    Plant Physiol., 2010. 154(4): p. 1855-70
    [PMID:20959420]
  10. Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY
    High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice.
    Theor. Appl. Genet., 2011. 122(8): p. 1489-96
    [PMID:21327937]
  11. Li H, et al.
    Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
    Plant Cell, 2011. 23(7): p. 2536-52
    [PMID:21784949]
  12. Yoshida H
    Is the lodicule a petal: molecular evidence?
    Plant Sci., 2012. 184: p. 121-8
    [PMID:22284716]
  13. Zhang Z, et al.
    Characterization and expression analysis of six MADS-box genes in maize (Zea mays L.).
    J. Plant Physiol., 2012. 169(8): p. 797-806
    [PMID:22440334]
  14. Duan Y, et al.
    Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.).
    Plant Mol. Biol., 2012. 80(4-5): p. 429-42
    [PMID:22933119]
  15. Wong CE,Singh MB,Bhalla PL
    Novel members of the AGAMOUS LIKE 6 subfamily of MIKCC-type MADS-box genes in soybean.
    BMC Plant Biol., 2013. 13: p. 105
    [PMID:23870482]
  16. Hu Z,Ding X,Hu S,Sun Y,Xia L
    Tissue-specifically regulated site-specific excision of selectable marker genes in bivalent insecticidal, genetically-modified rice.
    Biotechnol. Lett., 2013. 35(12): p. 2177-83
    [PMID:23974493]
  17. Bai X, et al.
    Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
    Sci Rep, 2016. 6: p. 19022
    [PMID:26744119]
  18. Dreni L,Zhang D
    Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes.
    J. Exp. Bot., 2016. 67(6): p. 1625-38
    [PMID:26956504]