PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

MIKC_MADS

Protein Properties

Length: 251aa MW: 28372.3 Da PI: 10.0112

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G147716_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.9	9.9e-32	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs++gklyeyss GRMZM2G147716_P01 10 RIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSS 59 8***********************************************96 PP
2	K-box	96.8	3.3e-32	86	171	12	97
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 ++++++ e+ +Lk++++ Lq++qR+llGe+L+sL++keLqqLeqqL++slk+iRs+Kn+l++++i+ lqkkek+l ++n L+k GRMZM2G147716_P01 86 EDQANWGDEYVRLKSKLDALQKSQRQLLGEQLSSLTIKELQQLEQQLDSSLKHIRSRKNQLMFDSISALQKKEKALTDQNGVLQKF 171 66799***************************************************************************999875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	6.0E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.31	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.59E-34	2	89	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.10E-42	2	74	No hit	No description
PRINTS	PR00404	3.9E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.4E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-31	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.9E-29	87	170	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	15.712	88	179	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010077	Biological Process	maintenance of inflorescence meristem identity
GO:0010154	Biological Process	fruit development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 251 aa Download sequence Send to blast
MGRGPVQLRR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFST KGKLYEYSSH 60 SSMEGILERY QRYSFEERAV LNPSIEDQAN WGDEYVRLKS KLDALQKSQR QLLGEQLSSL 120 TIKELQQLEQ QLDSSLKHIR SRKNQLMFDS ISALQKKEKA LTDQNGVLQK FMEAEKEKNK 180 ALMNAQLREQ QNGASTSSPS LSPPIVPDSM PTLNIGPCQH RGAAESESEP SPAPAQANRG 240 NLPPWMLRTV K

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	8e-22	1	74	1	73	MEF2 CHIMERA
6byy_B	8e-22	1	74	1	73	MEF2 CHIMERA
6byy_C	8e-22	1	74	1	73	MEF2 CHIMERA
6byy_D	8e-22	1	74	1	73	MEF2 CHIMERA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.14366	0.0	cell lignification\| ear\| endosperm\| meristem\| ovary\| pollen\| tassel

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G147716

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Not expressed at early stages of plant development. First detected in leaves 4 weeks after germination, and expression levels are increased when the plant reaches the reproductive stage. {ECO:0000269\|PubMed:15299121}.
Uniprot	TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269\|PubMed:10814814}.
Uniprot	TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269\|PubMed:11971906, ECO:0000269\|PubMed:15299121}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269\|PubMed:11971906, ECO:0000269\|PubMed:15299121}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G147716_P01

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ430695	0.0	AJ430695.1 Zea mays mRNA for putative MADS-domain transcription factor (m28 gene).
GenBank	BT033397	0.0	BT033397.1 Zea mays full-length cDNA clone ZM_BFb0049C14 mRNA, complete cds.
GenBank	EU962906	0.0	EU962906.1 Zea mays clone 246416 MADS-box transcription factor 18 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001105155.1	0.0	uncharacterized protein LOC542045
Swissprot	A2YNI2	1e-134	MAD18_ORYSI; MADS-box transcription factor 18
Swissprot	Q0D4T4	1e-134	MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBL	Q84V67	0.0	Q84V67_MAIZE; Agamous-like MADS-box protein AGL8
STRING	GRMZM2G147716_P01	0.0	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1151	37	113
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69120.1	2e-70	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	GRMZM2G147716_P01
Entrez Gene	542045

Publications ? help Back to Top
Jia H, et al. Characterization and transcriptional profiles of two rice MADS-box genes. Plant Sci., 2000. 155(2): p. 115-122 [PMID:10814814] Chen C, et al. Adapting rice anther culture to gene transformation and RNA interference. Sci. China, C, Life Sci., 2006. 49(5): p. 414-28 [PMID:17172048] Yoshida H, et al. superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] Yao SG,Ohmori S,Kimizu M,Yoshida H Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] Alexandrov NN, et al. Insights into corn genes derived from large-scale cDNA sequencing. Plant Mol. Biol., 2009. 69(1-2): p. 179-94 [PMID:18937034] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Wang H, et al. OsMADS32 interacts with PI-like proteins and regulates rice flower development. J Integr Plant Biol, 2015. 57(5): p. 504-13 [PMID:25081486] Lombardo F, et al. The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice. Plant Biotechnol. J., 2017. 15(1): p. 97-106 [PMID:27336225]