PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

bZIP

Protein Properties

Length: 138aa MW: 15186.9 Da PI: 10.9415

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G140355_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	47.7	3.4e-15	55	116	1	62
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +ke +r +r+ +NR++A+ R+RKka++ eLe +vkeLe+ N++L ++l++l++e + l++ GRMZM2G140355_P01 55 DKEHRRLKRLLRNRVSAQQARERKKAYLSELEVRVKELEKRNSELEEKLSTLQNENQMLRQI 116 58899****************************************************99886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PRINTS	PR00041	9.7E-5	54	70	IPR001630	cAMP response element binding (CREB) protein
SMART	SM00338	5.8E-15	55	119	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	3.3E-14	56	117	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	12.817	57	120	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	4.6E-17	59	119	No hit	No description
SuperFamily	SSF57959	1.94E-13	59	117	No hit	No description
PROSITE pattern	PS00036	0	62	77	IPR004827	Basic-leucine zipper domain
CDD	cd14704	1.93E-11	69	111	No hit	No description
PRINTS	PR00041	9.7E-5	72	92	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	9.7E-5	92	109	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 138 aa Download sequence Send to blast
MESDEEIRRV PEVGLELLTS PSTSGREATA AAAAAGTSSA SQAASASRRG RSPADKEHRR 60 LKRLLRNRVS AQQARERKKA YLSELEVRVK ELEKRNSELE EKLSTLQNEN QMLRQILKNT 120 TVNNRRGPGS SSAGGDSQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2oqq_A	2e-15	80	119	3	42	Transcription factor HY5
2oqq_B	2e-15	80	119	3	42	Transcription factor HY5
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G140355

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269\|PubMed:15178762}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G140355_P01

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK375694	3e-66	AK375694.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3101I12.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008659719.1	6e-91	transcription factor HY5
Swissprot	Q9SM50	6e-51	HY5_SOLLC; Transcription factor HY5
TrEMBL	A0A3L6DGG9	1e-90	A0A3L6DGG9_MAIZE; Transcription factor HY5
TrEMBL	K7VAC7	1e-90	K7VAC7_MAIZE; Putative bZIP transcription factor superfamily protein
STRING	GRMZM2G140355_P01	2e-91	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1408	38	111
Representative plant	OGRP2081	17	37

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G11260.1	6e-38	bZIP family protein

Link Out ? help Back to Top
Phytozome	GRMZM2G140355_P01

Publications ? help Back to Top
Wang F, et al. Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato. Plant Physiol., 2018. 176(2): p. 1311-1326 [PMID:29146776] Liu CC, et al. The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato. Plant Cell Environ., 2018. 41(8): p. 1762-1775 [PMID:29566255]