![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G129247_P03 | ||||||||
Common Name | bZIP101, LOC100279460 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 254aa MW: 27087.4 Da PI: 8.2049 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 37.1 | 6.6e-12 | 175 | 220 | 5 | 50 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 +r++r++kNRe+A rsR RK+a+i+eLe v +Le+ +L e e GRMZM2G129247_P03 175 QRQKRMIKNRESAARSRDRKQAYIAELESQVMQLEEYQAELLTEQE 220 89*********************************99998886654 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.5E-7 | 171 | 240 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.979 | 173 | 225 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.2E-10 | 174 | 220 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 4.86E-16 | 175 | 220 | No hit | No description |
SuperFamily | SSF57959 | 5.27E-10 | 176 | 224 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 4.0E-12 | 176 | 230 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 178 | 193 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 254 aa Download sequence Send to blast |
MASSRVMASS SPPQHAGAGS SSDLARFRSS GGIGSMNMDN IMREIYGPEA VNATVNGRVE 60 PSPAAPEAAA RRTSEEVWKE ISAAGGLSAP VLPPPPAAST GAGARGGGGG ASEMTLEDFL 120 ARDSCAMAAV MEGDMALGFP NCEGDAAGSV AGEAGGGRGS RKRALLDPAD RAVMQRQKRM 180 IKNRESAARS RDRKQAYIAE LESQVMQLEE YQAELLTEQE DRRQKRLKEL VERVVPVIRK 240 KSPQDLRRNN SMEW |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.29744 | 0.0 | endosperm| meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G129247 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G129247_P03 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT037130 | 0.0 | BT037130.1 Zea mays full-length cDNA clone ZM_BFb0156A01 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001347900.1 | 0.0 | uncharacterized protein LOC100279460 | ||||
Swissprot | Q0JHF1 | 8e-56 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
TrEMBL | B4FJ42 | 0.0 | B4FJ42_MAIZE; BZIP transcription factor | ||||
STRING | GRMZM2G129247_P03 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2665 | 37 | 86 | Representative plant | OGRP9845 | 4 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G44080.1 | 4e-23 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G129247_P03 |
Publications ? help Back to Top | |||
---|---|---|---|
|