![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G118250_P06 | ||||||||
Common Name | AS2, IG1, LBD6 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 260aa MW: 26721 Da PI: 7.8357 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 138.1 | 3.2e-43 | 33 | 131 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +CaaCk+lrrkC++dCv+apyfp ++p+kf vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+ql++ GRMZM2G118250_P06 33 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQHNLRQLQQ 124 7******************************************************************************************* PP DUF260 93 elallke 99 +la++k GRMZM2G118250_P06 125 DLARAKY 131 **99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.729 | 32 | 133 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.1E-43 | 33 | 129 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009799 | Biological Process | specification of symmetry | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0009954 | Biological Process | proximal/distal pattern formation | ||||
GO:0048441 | Biological Process | petal development | ||||
GO:0005654 | Cellular Component | nucleoplasm | ||||
GO:0005515 | Molecular Function | protein binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 260 aa Download sequence Send to blast |
MASSVPAPSG SVITVASSSS SAAAAAVCGT GSPCAACKFL RRKCQPDCVF APYFPPDNPQ 60 KFVHVHRVFG ASNVTKLLNE LHPFQREDAV NSLAYEADMR LRDPVYGCVG VISILQHNLR 120 QLQQDLARAK YELSKYQAAA AASASTAPTG PQAMAEFIGN AMPNGAHNFI NIGHSAALGS 180 LGGSASVFGQ EQFGNAQMLS RSYDGGEPIA RLGINGGGYE FGYSTAMGGS GAVSGLGTLG 240 ISPFLKSGTA GGDEKPNGGQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-53 | 23 | 136 | 1 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-53 | 23 | 136 | 1 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.100444 | 0.0 | meristem| ovary |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G118250 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In embryo sac, detected as early as the one-nucleus stage. In older embryo sacs, highest expression in antipodal cells. {ECO:0000269|PubMed:17209126}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves, leaf primordia, immature ears, immature tassels, whole ovules, silk and husk leaves. Found on the adaxial side of organs. {ECO:0000269|PubMed:17209126}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00211 | DAP | Transfer from AT1G65620 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G118250_P06 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
IntAct | Search Q32SG3 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY940681 | 0.0 | AY940681.1 Zea mays ASYMMETRIC LEAVES2 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105838.1 | 0.0 | LOB domain-containing protein 6 | ||||
Refseq | XP_008673456.1 | 0.0 | LOB domain-containing protein 6 isoform X1 | ||||
Refseq | XP_020405662.1 | 0.0 | LOB domain-containing protein 6 isoform X1 | ||||
Swissprot | Q32SG3 | 0.0 | LBD6_MAIZE; LOB domain-containing protein 6 | ||||
TrEMBL | A0A1R3PRT6 | 0.0 | A0A1R3PRT6_MAIZE; LOB domain-containing protein 6 | ||||
TrEMBL | A0A3L6FRU8 | 0.0 | A0A3L6FRU8_MAIZE; LOB domain-containing protein 6 | ||||
STRING | GRMZM2G118250_P06 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65620.4 | 4e-58 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G118250_P06 |
Entrez Gene | 732739 |
Publications ? help Back to Top | |||
---|---|---|---|
|