PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G118250_P01
Common NameAS2, IG1, LBD6
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family LBD
Protein Properties Length: 139aa    MW: 15115.3 Da    PI: 8.599
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G118250_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.46e-4433131199
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+ql++
  GRMZM2G118250_P01  33 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQHNLRQLQQ 124
                        7******************************************************************************************* PP

             DUF260  93 elallke 99 
                        +la++k 
  GRMZM2G118250_P01 125 DLARAKY 131
                        **99886 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.72932133IPR004883Lateral organ boundaries, LOB
PfamPF031957.9E-4433129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MASSVPAPSG SVITVASSSS SAAAAAVCGT GSPCAACKFL RRKCQPDCVF APYFPPDNPQ  60
KFVHVHRVFG ASNVTKLLNE LHPFQREDAV NSLAYEADMR LRDPVYGCVG VISILQHNLR  120
QLQQDLARAK YELSKYQVM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-55231361114LOB family transfactor Ramosa2.1
5ly0_B8e-55231361114LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1004440.0meristem| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G118250
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In embryo sac, detected as early as the one-nucleus stage. In older embryo sacs, highest expression in antipodal cells. {ECO:0000269|PubMed:17209126}.
UniprotTISSUE SPECIFICITY: Expressed in leaves, leaf primordia, immature ears, immature tassels, whole ovules, silk and husk leaves. Found on the adaxial side of organs. {ECO:0000269|PubMed:17209126}.
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Function -- GeneRIF ? help Back to Top
  1. The indeterminate gametophyte1 (ig1) gene of Zea mays restricts the proliferative phase of female gametophyte development. [IG1]
    [PMID: 17209126]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G118250_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q32SG3
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0814540.0EF081454.1 Zea mays indeterminate gametophyte 1 (IG1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105838.11e-98LOB domain-containing protein 6
RefseqXP_008673456.11e-98LOB domain-containing protein 6 isoform X1
RefseqXP_008673457.12e-98LOB domain-containing protein 6 isoform X2
RefseqXP_020405662.11e-98LOB domain-containing protein 6 isoform X1
RefseqXP_021311341.11e-98LOB domain-containing protein 6 isoform X1
RefseqXP_021311342.11e-98LOB domain-containing protein 6 isoform X1
SwissprotQ32SG31e-99LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A1D6N5704e-97A0A1D6N570_MAIZE; LOB domain-containing protein 6
TrEMBLA0A1R3PRT63e-97A0A1R3PRT6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A1W0W0X13e-97A0A1W0W0X1_SORBI; Uncharacterized protein
TrEMBLA0A3L6FRU83e-97A0A3L6FRU8_MAIZE; LOB domain-containing protein 6
STRINGGRMZM2G118250_P065e-98(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.45e-60LBD family protein
Publications ? help Back to Top
  1. Phelps-Durr TL,Thomas J,Vahab P,Timmermans MC
    Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis.
    Plant Cell, 2005. 17(11): p. 2886-98
    [PMID:16243907]
  2. Evans MM
    The indeterminate gametophyte1 gene of maize encodes a LOB domain protein required for embryo Sac and leaf development.
    Plant Cell, 2007. 19(1): p. 46-62
    [PMID:17209126]