 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
GRMZM2G064197_P02 |
| Common Name | LOC100282824 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
| Family |
G2-like |
| Protein Properties |
Length: 111aa MW: 11982.8 Da PI: 10.6477 |
| Description |
G2-like family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| GRMZM2G064197_P02 | genome | MaizeSequence | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | G2-like | 108.3 | 3.9e-34 | 37 | 91 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kprlrWt +LHerFv+av+qLGG+ekAtPktil++m+vkgLtl h+kSHLQkYRl
GRMZM2G064197_P02 37 KPRLRWTADLHERFVDAVAQLGGPEKATPKTILRTMGVKGLTLFHLKSHLQKYRL 91
79****************************************************8 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0009567 | Biological Process | double fertilization forming a zygote and endosperm |
| GO:0010628 | Biological Process | positive regulation of gene expression |
| GO:0016036 | Biological Process | cellular response to phosphate starvation |
| GO:0005634 | Cellular Component | nucleus |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 6j4r_A | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 4e-21 | 37 | 93 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase |
| Expression -- UniGene
? help Back to Top |
| UniGene ID |
E-value |
Expressed in |
| Zm.117878 | 1e-179 | ear| embryo| endosperm| glume| meristem| root| tassel |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | BT037347 | 1e-177 | BT037347.1 Zea mays full-length cDNA clone ZM_BFb0165E16 mRNA, complete cds. |
| GenBank | EU962431 | 1e-177 | EU962431.1 Zea mays clone 242603 myb family transcription factor-related protein mRNA, complete cds. |
| GenBank | KJ726856 | 1e-177 | KJ726856.1 Zea mays clone pUT3396 G2-like transcription factor (GLK1) mRNA, partial cds. |
