![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G041127_P04 | ||||||||
Common Name | hdz10, si606017c07 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 274aa MW: 29643.9 Da PI: 4.3511 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 60.2 | 3.4e-19 | 52 | 105 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k++++++eq+++Le+ Fe ++++ e++++LA+ lgL+ rqV vWFqNrRa++k GRMZM2G041127_P04 52 KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 105 45689************************************************9 PP | |||||||
2 | HD-ZIP_I/II | 132.9 | 1.2e-42 | 51 | 143 | 1 | 93 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 ekkrrls+eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+r+ydal+ ++++L++++++L +e++ GRMZM2G041127_P04 51 EKKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRRSYDALRLDHDALRRDKDALLAEIR 142 69*************************************************************************************99998 PP HD-ZIP_I/II 93 e 93 e GRMZM2G041127_P04 143 E 143 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 7.94E-20 | 41 | 109 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.475 | 47 | 107 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.5E-18 | 50 | 111 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 1.6E-16 | 52 | 105 | IPR001356 | Homeobox domain |
CDD | cd00086 | 6.52E-18 | 52 | 108 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.6E-20 | 53 | 114 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 9.3E-6 | 78 | 87 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 82 | 105 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 9.3E-6 | 87 | 103 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 1.5E-17 | 107 | 148 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 274 aa Download sequence Send to blast |
MSWRECVRNE DLSPCACVFP DDGYGVLGME ADVDVDVDEE MMAFGGGGGG EKKRRLSAEQ 60 VRALERSFEV ENKLEPERKA RLARDLGLQP RQVAVWFQNR RARWKTKQLE RDYAALRRSY 120 DALRLDHDAL RRDKDALLAE IRELKAKLGD DEDAAASFTS VKAEPAASDG PAPAGVGSSE 180 ISDSSAVLND ADPPVAEAPA PAPEVQGTLL VAPAGPVAGA AAANHGGVFF HGSFLKVEED 240 ETGLLDDDGP CGGFFAVEQP PAMAWWNEPA EHWN |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 76 | 82 | ERKARLA |
2 | 99 | 107 | RRARWKTKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.84749 | 0.0 | ear| endosperm| meristem| ovary |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G041127 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaf and floral organ primordia, floral meristems, embryonic axis and cells surrounding the vascular bundles. Expressed in the vasculature of roots, stem, leaves and spikelets, and in the vascular bundle of the scutellum in embryos. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaf and floral organ primordia, floral meristems, embryonic axis and cells surrounding the vascular bundles. Expressed in the vasculature of roots, stem, leaves and spikelets, and in the vascular bundle of the scutellum in embryos. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. | |||||
UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G041127_P04 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX514832 | 0.0 | JX514832.1 Zea mays cultivar B73 homeodomain leucine zipper protein 10 (hdz10) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008667301.1 | 0.0 | homeodomain leucine zipper protein 10 isoform X1 | ||||
Swissprot | Q6K498 | 1e-110 | HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4 | ||||
Swissprot | Q9XH37 | 1e-110 | HOX4_ORYSI; Homeobox-leucine zipper protein HOX4 | ||||
TrEMBL | K0E873 | 0.0 | K0E873_MAIZE; Homeodomain leucine zipper protein 10 | ||||
STRING | GRMZM2G041127_P04 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G40060.1 | 1e-49 | homeobox protein 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G041127_P04 |
Entrez Gene | 100194336 |
Publications ? help Back to Top | |||
---|---|---|---|
|