![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G021339_P02 | ||||||||
Common Name | pco078109, ZEAMMB73_703215 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 299aa MW: 33147.1 Da PI: 4.2768 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 64.7 | 1.3e-20 | 34 | 87 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k++++t+eq++ Le+ Fe+++++ e+++eLA+klgL+ rqV vWFqNrRa++k GRMZM2G021339_P02 34 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 87 5678*************************************************9 PP | |||||||
2 | HD-ZIP_I/II | 132.8 | 1.3e-42 | 33 | 124 | 1 | 92 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktkqlE+d+++Lk+++dal++++++L +++++Lr+++ GRMZM2G021339_P02 33 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFDALRADHDALLQDNHRLRSQVV 124 69**************************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 4.6E-20 | 27 | 91 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 18.22 | 29 | 89 | IPR001356 | Homeobox domain |
SMART | SM00389 | 2.0E-20 | 32 | 93 | IPR001356 | Homeobox domain |
CDD | cd00086 | 3.17E-19 | 34 | 90 | No hit | No description |
Pfam | PF00046 | 6.8E-18 | 34 | 87 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 7.0E-22 | 35 | 96 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 1.8E-6 | 60 | 69 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 64 | 87 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 1.8E-6 | 69 | 85 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 4.0E-18 | 89 | 130 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001558 | Biological Process | regulation of cell growth | ||||
GO:0009637 | Biological Process | response to blue light | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009965 | Biological Process | leaf morphogenesis | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 299 aa Download sequence Send to blast |
MLGLEEGRGV KRPFYTSPDE LLEEEYYDEQ LPEKKRRLTP EQVHLLERSF EEENKLEPER 60 KTELARKLGL QPRQVAVWFQ NRRARWKTKQ LERDFDRLKA SFDALRADHD ALLQDNHRLR 120 SQVVSLTEKL REKEATEGDA NGAAAALPAV GVVRASVADD VEEPEPEPEP EAEAAAFEER 180 QVKSEDRLST GSGGSAVVDA ADALLYNGRI GGAAVDSSVE SYFPGAEVQD QYHGCGTMGP 240 VTHGAGGIQS DDDDGAGSDE GCSYYADEEA AAAFLSEHTH HADGDDEDAG QVSWWWMWN |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 81 | 89 | RRARWKTKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.118699 | 0.0 | ear| endosperm |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G021339 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00323 | DAP | Transfer from AT3G01470 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G021339_P02 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT067017 | 0.0 | BT067017.1 Zea mays full-length cDNA clone ZM_BFb0151L17 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008677601.1 | 0.0 | putative homeobox DNA-binding and leucine zipper domain family protein isoform X1 | ||||
Swissprot | A2X980 | 1e-119 | HOX16_ORYSI; Homeobox-leucine zipper protein HOX16 | ||||
Swissprot | Q6YWR4 | 1e-119 | HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16 | ||||
TrEMBL | A0A3L6F711 | 0.0 | A0A3L6F711_MAIZE; Homeobox-leucine zipper protein HOX16 | ||||
TrEMBL | K7U8D5 | 0.0 | K7U8D5_MAIZE; Putative homeobox DNA-binding and leucine zipper domain family protein isoform 1 | ||||
STRING | GRMZM2G021339_P01 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01470.1 | 1e-60 | homeobox 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G021339_P02 |
Entrez Gene | 100383369 |
Publications ? help Back to Top | |||
---|---|---|---|
|