PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G019335_P01 | ||||||||
Common Name | cl359_1(434), Orphan179, ZEAMMB73_777196 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 253aa MW: 27234.4 Da PI: 4.7373 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 23.2 | 1.5e-07 | 4 | 46 | 5 | 41 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 C+ +e ++ C ++ lC+ C +e+H H++ p GRMZM2G019335_P01 4 QCDACEGAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46 7******99*********************6678888898877 PP | |||||||
2 | zf-B_box | 26.8 | 1.1e-08 | 54 | 85 | 3 | 34 |
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedClleeH 34 ++C+ ++ek + +fC +++ l+C+dC + +H GRMZM2G019335_P01 54 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 85 689**************************999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 10.011 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 9.60E-6 | 3 | 47 | No hit | No description |
SMART | SM00336 | 2.1E-9 | 4 | 47 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 1.1E-5 | 4 | 47 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 8.2E-14 | 52 | 99 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 8.66 | 52 | 99 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 1.96E-6 | 55 | 85 | No hit | No description |
Pfam | PF00643 | 2.0E-6 | 55 | 95 | IPR000315 | B-box-type zinc finger |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010100 | Biological Process | negative regulation of photomorphogenesis | ||||
GO:0005622 | Cellular Component | intracellular | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 253 aa Download sequence Send to blast |
MKIQCDACEG AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLEAL SASLPRCDVC 60 QEKAAFIFCV EDRALFCRDC DEPIHVPGTL SGNHQRYLAT DIRVGFASAS SACSDACDAH 120 DDSDHHAPPK AAVSSAAQQV PSPPQFLPQG WAVDELLQFS DCESSDKLHK ESPLGFKELE 180 WFTDIDLFHE QTPKAGRRLA EVPELSGTQA ANDAAYYRPA KATATAGAGV RQSKKARTEV 240 TDDEDHLIVP DLG |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.118395 | 0.0 | ear| endosperm| meristem| ovary |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G019335 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of seedling photomorphogenesis (PubMed:18540109). BBX25/STH and BBX24/STO function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX25/STH acts additively with BBX24/STO during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). {ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:23624715}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G019335_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT041818 | 0.0 | BT041818.1 Zea mays full-length cDNA clone ZM_BFb0060E09 mRNA, complete cds. | |||
GenBank | EU956191 | 0.0 | EU956191.1 Zea mays clone 1558749 salt tolerance-like protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001141667.1 | 0.0 | uncharacterized LOC100273793 | ||||
Swissprot | Q9SID1 | 2e-76 | BBX25_ARATH; B-box zinc finger protein 25 | ||||
TrEMBL | B4FXI0 | 0.0 | B4FXI0_MAIZE; B-box zinc finger protein 24 | ||||
STRING | GRMZM2G019335_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3202 | 33 | 68 |
Representative plant | OGRP5397 | 10 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06040.1 | 4e-74 | DBB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G019335_P01 |
Entrez Gene | 100273793 |
Publications ? help Back to Top | |||
---|---|---|---|
|