 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
GRMZM2G016020_P01 |
Common Name | P |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
Family |
MYB_related |
Protein Properties |
Length: 88aa MW: 10021.6 Da PI: 9.775 |
Description |
MYB_related family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
GRMZM2G016020_P01 | genome | MaizeSequence | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 61.1 | 2.3e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rgrWT+eEd+ll+++++++G g+W++ ++ g+ R++k+c++rw +yl
GRMZM2G016020_P01 14 RGRWTAEEDQLLANYIAEHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
8*******************************99************97 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | KJ728395 | 1e-146 | KJ728395.1 Zea mays clone pUT6679 MYB transcription factor (MYB3) mRNA, partial cds. |
GenBank | ZMU57002 | 1e-146 | U57002.1 Zea mays P protein (P) mRNA, complete cds. |
Publications
? help Back to Top |
- Athma P,Grotewold E,Peterson T
Insertional mutagenesis of the maize P gene by intragenic transposition of Ac. Genetics, 1992. 131(1): p. 199-209 [PMID:1317315] - Robbins ML,Sekhon RS,Meeley R,Chopra S
A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize. Genetics, 2008. 178(4): p. 1859-74 [PMID:18430921] - Sidorenko L,Chandler V
RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene. Genetics, 2008. 180(4): p. 1983-93 [PMID:18845841] - Robbins ML,Wang P,Sekhon RS,Chopra S
Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism. PLoS ONE, 2009. 4(12): p. e8231 [PMID:20011605] - Grotewold E,Athma P,Peterson T
Alternatively spliced products of the maize P gene encode proteins with homology to the DNA-binding domain of myb-like transcription factors. Proc. Natl. Acad. Sci. U.S.A., 1991. 88(11): p. 4587-91 [PMID:2052542] - Rhee Y,Sekhon RS,Chopra S,Kaeppler S
Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize. Genetics, 2010. 186(3): p. 843-55 [PMID:20823340] - Morohashi K, et al.
A genome-wide regulatory framework identifies maize pericarp color1 controlled genes. Plant Cell, 2012. 24(7): p. 2745-64 [PMID:22822204]
|