![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G012724_P03 | ||||||||
Common Name | LOC100281558 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 254aa MW: 26744.3 Da PI: 7.595 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 25.8 | 2.1e-08 | 2 | 27 | 35 | 60 |
EEEEEE-SSSTTEEEEEEES--SS-- CS WRKY 35 kkkversaedpkvveitYegeHnhek 60 kkkvers d++v++i+Y+g Hnh+k GRMZM2G012724_P03 2 KKKVERSLADGRVTQIVYKGAHNHPK 27 9***********************85 PP | |||||||
2 | WRKY | 105.1 | 3.7e-33 | 130 | 188 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYGqK+vkg+++prsYY+Ct+agCpv+k+ver+ +d ++v++tYeg+Hnh+ GRMZM2G012724_P03 130 LDDGFRWRKYGQKVVKGNPNPRSYYKCTTAGCPVRKHVERACHDARAVITTYEGKHNHD 188 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 9.443 | 1 | 28 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 4.1E-5 | 2 | 28 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 1.3E-36 | 115 | 190 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.62E-29 | 122 | 190 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 37.929 | 125 | 190 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.5E-38 | 130 | 189 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.2E-26 | 131 | 188 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 254 aa Download sequence Send to blast |
MKKKVERSLA DGRVTQIVYK GAHNHPKPLS TRRNSSGGVA AAEEQAANNS SLSGCGGPEH 60 SGGATAENSS VTFGDDEAEN GSQRSGGDEP DAKRWKAEDG ENEGSSGAGG GKPVREPRLV 120 VQTLSDIDIL DDGFRWRKYG QKVVKGNPNP RSYYKCTTAG CPVRKHVERA CHDARAVITT 180 YEGKHNHDVP VGRGAASRAA AAAPLLGSGG GQMDHRHQQP YTLEMLSGGG GGYGGGYAAK 240 DEPRDDLFVD SLLC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-37 | 104 | 190 | 1 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 4e-37 | 104 | 190 | 1 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.97273 | 0.0 | endosperm| leaf| meristem| ovary| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G012724 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In dry seeds, expressed in aleurone cells and embryos. Levels drop rapidly but transiently in the embryos of imbibed seeds. {ECO:0000269|PubMed:19199048}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in aleurone cells (PubMed:15618416). Mostly expressed in aleurone layers and leaves, and, to a lower extent, in roots, panicles and embryos (PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:26025535}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G012724_P03 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU957097 | 0.0 | EU957097.1 Zea mays clone 1582655 WRKY53 - superfamily of TFs having WRKY and zinc finger domains mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008647807.1 | 1e-159 | WRKY53 - superfamily of TFs having WRKY and zinc finger domains isoform X1 | ||||
Swissprot | Q6IEQ7 | 6e-81 | WRK24_ORYSJ; WRKY transcription factor WRKY24 | ||||
TrEMBL | A0A3L6E8L6 | 1e-158 | A0A3L6E8L6_MAIZE; WRKY transcription factor WRKY24 | ||||
STRING | GRMZM2G012724_P01 | 1e-159 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38470.1 | 4e-60 | WRKY DNA-binding protein 33 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G012724_P03 |
Publications ? help Back to Top | |||
---|---|---|---|
|