 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
GRMZM2G003514_P01 |
| Common Name | MADS5, ZEAMMB73_316255 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
| Family |
MIKC_MADS |
| Protein Properties |
Length: 255aa MW: 28913.8 Da PI: 8.2893 |
| Description |
MIKC_MADS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| GRMZM2G003514_P01 | genome | MaizeSequence | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 97.8 | 4.4e-31 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifs +gklye+
GRMZM2G003514_P01 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSGRGKLYEFG 58
79**********************************************95 PP
|
| 2 | K-box | 102.5 | 5.5e-34 | 76 | 172 | 3 | 99 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94
++++++ + ++++s++qe++kL+++ e Lqr+qRhllGedL++Ls+keLqqLe+qLe +l++ R++K++l++eq+eel++ e+ l e n++L
GRMZM2G003514_P01 76 AQDSNNGALSESQSWYQEISKLRAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRTERHLGEMNRQL 167
455555677788******************************************************************************** PP
K-box 95 rkkle 99
++kle
GRMZM2G003514_P01 168 KHKLE 172
***97 PP
|
| Protein Features
? help Back to Top |
 |
| Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
| PROSITE profile | PS50066 | 33.235 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.4E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 5.23E-33 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.88E-46 | 2 | 78 | No hit | No description |
| PRINTS | PR00404 | 2.3E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.4E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 3.1E-30 | 86 | 171 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 17.377 | 87 | 177 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0009911 | Biological Process | positive regulation of flower development |
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem |
| GO:0048437 | Biological Process | floral organ development |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0046983 | Molecular Function | protein dimerization activity |
| Sequence ? help Back to Top |
| Protein Sequence Length: 255 aa
Download sequence Send
to blast |
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSG RGKLYEFGSA 60
GVTKTLERYQ HCCYNAQDSN NGALSESQSW YQEISKLRAK FEALQRTQRH LLGEDLGPLS 120
VKELQQLEKQ LECALSQARQ RKTQLMMEQV EELRRTERHL GEMNRQLKHK LEAEGCSNYT 180
TLQHAACWPA PGGTIVEHDG ATYQVHPPAH SVAMDCEPTL QIGYPHHQFP PPEAANNIPR 240
SAATGENNFM LGWVL
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 4ox0_A | 1e-21 | 83 | 175 | 13 | 104 | Developmental protein SEPALLATA 3 |
| 4ox0_B | 1e-21 | 83 | 175 | 13 | 104 | Developmental protein SEPALLATA 3 |
| 4ox0_C | 1e-21 | 83 | 175 | 13 | 104 | Developmental protein SEPALLATA 3 |
| 4ox0_D | 1e-21 | 83 | 175 | 13 | 104 | Developmental protein SEPALLATA 3 |
| Search in ModeBase |
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development in the inner and outer integuments. Not detected in young panicles. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:19820190}. |
| Uniprot | TISSUE SPECIFICITY: Expressed in the floral meristem. Highly expressed in lodicules. Expressed in palea and pistil. Weakly expressed in carpels, empty glumes and stamens. Not detected in lemmas. {ECO:0000269|PubMed:10444103, ECO:0000269|PubMed:19820190}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269|PubMed:19820190, ECO:0000269|Ref.8}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | BT087751 | 0.0 | BT087751.1 Zea mays full-length cDNA clone ZM_BFb0184N10 mRNA, complete cds. |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Li H, et al.
The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice.
Cell Res., 2010. 20(3): p. 299-313
[PMID:20038961] - Zhang J,Nallamilli BR,Mujahid H,Peng Z
OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa).
Plant J., 2010. 64(4): p. 604-17
[PMID:20822505] - Seok HY, et al.
Rice ternary MADS protein complexes containing class B MADS heterodimer.
Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
[PMID:20888318] - Li H, et al.
Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
Plant Cell, 2011. 23(7): p. 2536-52
[PMID:21784949] - Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U
Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility.
Plant Cell Physiol., 2011. 52(12): p. 2123-35
[PMID:22016342] - Duan Y, et al.
Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.).
Plant Mol. Biol., 2012. 80(4-5): p. 429-42
[PMID:22933119] - Conrad LJ, et al.
The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice.
Plant J., 2014. 80(5): p. 883-94
[PMID:25279942] - Zhang J, et al.
Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice.
J. Exp. Bot., 2015. 66(1): p. 99-112
[PMID:25324400] - Bai X, et al.
Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
Sci Rep, 2016. 6: p. 19022
[PMID:26744119] - Zhang B, et al.
A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.).
PLoS Genet., 2016. 12(7): p. e1006152
[PMID:27367609]
|
