![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_rscf00001592.1.g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 91aa MW: 10387.8 Da PI: 9.009 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.6 | 6.8e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgrWT+eEde+l ++++++G g+W++ ++ g+ R++k+c++rw +yl FANhyb_rscf00001592.1.g00002.1 14 RGRWTAEEDEILTNYIQLHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61 8*******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.257 | 9 | 65 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-20 | 12 | 59 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.49E-22 | 15 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.34E-10 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.8E-7 | 60 | 87 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MGRAPCCEKV GLKRGRWTAE EDEILTNYIQ LHGEGSWRSL PKNAGLLRCG KSCRLRWINY 60 LRTDLRRGNI TQEEEETIVK LHTALGNSTS T |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:15923334, ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00668 | SELEX | Transfer from GRMZM2G016020 | Download |
![]() |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:9839469}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004295109.1 | 1e-56 | PREDICTED: myb-related protein 330 | ||||
Swissprot | O22264 | 2e-49 | MYB12_ARATH; Transcription factor MYB12 | ||||
TrEMBL | A0A2P6QYV0 | 9e-55 | A0A2P6QYV0_ROSCH; Putative transcription factor MYB-HB-like family | ||||
TrEMBL | F2QKX3 | 9e-55 | F2QKX3_ROSHC; Putative MYB transcription factor | ||||
STRING | XP_004295109.1 | 4e-56 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47460.1 | 1e-51 | myb domain protein 12 |