PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

HSF

Protein Properties

Length: 106aa MW: 11779.4 Da PI: 4.1074

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_rscf00000797.1.g00003.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	74.9	1.4e-23	43	101	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k++++++d++l+ +isw + g sfvv+d+ ef++ vLp+ Fkh+nf+SFvRQLn+Y FANhyb_rscf00000797.1.g00003.1 43 FLSKTFDLVDDPALDLIISWGSAGASFVVWDPVEFSRLVLPRNFKHNNFSSFVRQLNTY 101 9*********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	4.4E-25	36	101	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	9.2E-18	39	106	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	7.07E-22	39	101	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	1.0E-12	43	66	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	1.2E-19	43	101	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.0E-12	81	93	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.0E-12	94	106	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MFPREPELDP GMGESMELEG QLSGCVGVPQ PLQSLQETPV PPFLSKTFDL VDDPALDLII 60 SWGSAGASFV VWDPVEFSRL VLPRNFKHNN FSSFVRQLNT YVGILQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	1e-17	20	101	6	87	Heat shock factor protein 1
5d5v_B	1e-17	20	101	6	87	Heat shock factor protein 1
5d5v_D	1e-17	20	101	6	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269\|PubMed:17999647, ECO:0000269\|PubMed:18261981}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:17999647, ECO:0000269\|PubMed:18261981}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011466795.1	3e-64	PREDICTED: heat stress transcription factor A-3
Swissprot	Q8GYY1	1e-35	HSFA3_ARATH; Heat stress transcription factor A-3
TrEMBL	A0A2P6RBH4	5e-49	A0A2P6RBH4_ROSCH; Putative transcription factor HSF-type-DNA-binding family
STRING	XP_004305364.1	2e-58	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G03720.1	5e-38	heat shock transcription factor A3

Publications ? help Back to Top
Jung HS, et al. Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9 [PMID:23918368] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nie S,Yue H,Xing D A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] Hu Z, et al. Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis. Plant J., 2015. 84(6): p. 1178-91 [PMID:26576681] Song C,Chung WS,Lim CO Overexpression of Heat Shock Factor Gene HsfA3 Increases Galactinol Levels and Oxidative Stress Tolerance in Arabidopsis. Mol. Cells, 2016. 39(6): p. 477-83 [PMID:27109422] Kim GD,Cho YH,Lee BH,Yoo SD STABILIZED1 Modulates Pre-mRNA Splicing for Thermotolerance. Plant Physiol., 2017. 173(4): p. 2370-2382 [PMID:28223317] Song C,Lee J,Kim T,Hong JC,Lim CO VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis. Planta, 2018. 247(6): p. 1439-1448 [PMID:29536220]