 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
FANhyb_rscf00000441.1.g00001.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
Family |
M-type_MADS |
Protein Properties |
Length: 94aa MW: 10867 Da PI: 11.0448 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
FANhyb_rscf00000441.1.g00001.1 | genome | kazusa | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 99.3 | 1.5e-31 | 42 | 92 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELS+LC+aeva+i+fss+g+lyeys+
FANhyb_rscf00000441.1.g00001.1 42 KRIENTTNRQVTFCKRRNGLLKKAYELSILCEAEVALIVFSSRGRLYEYSN 92
79***********************************************95 PP
|
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1tqe_P | 3e-20 | 34 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-20 | 34 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-20 | 34 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-20 | 34 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-20 | 34 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-20 | 34 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-20 | 34 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-20 | 34 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-20 | 34 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-20 | 34 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269|PubMed:15254538, ECO:0000269|PubMed:19956801}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269|PubMed:10198637, ECO:0000269|PubMed:11058164, ECO:0000269|PubMed:1675158, ECO:0000269|PubMed:17794879, ECO:0000269|PubMed:18281509, ECO:0000269|PubMed:19783648, ECO:0000269|PubMed:9783581}. |