PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_icon19357301_s.1.g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 67aa MW: 7891.98 Da PI: 8.9185 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.5 | 4.7e-11 | 1 | 41 | 8 | 48 |
HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 Ede+l ++ G g+W+ Iar + R++k+c++rw +yl FANhyb_icon19357301_s.1.g00001.1 1 EDEKLMRYMLSNGQGCWSDIARNSSLQRCGKSCRLRWINYL 41 9**************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF13921 | 2.6E-11 | 1 | 57 | No hit | No description |
PROSITE profile | PS51294 | 19.209 | 1 | 45 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-17 | 1 | 44 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.67E-16 | 1 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.17E-5 | 1 | 41 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-7 | 45 | 67 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 67 aa Download sequence Send to blast |
EDEKLMRYML SNGQGCWSDI ARNSSLQRCG KSCRLRWINY LRPDLKRGAF SPQEEHQIIH 60 FHSILGN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Involved in the regulation of secondary wall biosynthesis in fibers and vessels (PubMed:17890373). Transcription activator of the mannan synthase CSLA9 that recognizes and binds to the DNA consensus sequence 5'-[AG][GT]T[AT]GGT[GA]-3' cis-regulatory element of CSLA9 promoter (PubMed:24243147). Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1. Functions redundantly with MYB83 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). Is an obligate component of the transcriptional regulatory complex toward the commitment of secondary wall cellulose synthesis. Is required for functional expression of the three secondary wall CESA genes, CESA4, CESA7 and CESA8 (PubMed:23726771). {ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:23726771, ECO:0000269|PubMed:24243147}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (SA). Positively regulated by SND1 and homolog proteins. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17890373}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024170964.1 | 4e-41 | transcription factor MYB46-like | ||||
Swissprot | Q9LXV2 | 1e-37 | MYB46_ARATH; Transcription factor MYB46 | ||||
TrEMBL | A0A2P6S7H6 | 9e-40 | A0A2P6S7H6_ROSCH; Putative transcription factor MYB-HB-like family | ||||
STRING | XP_004308219.1 | 2e-40 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF774 | 34 | 128 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G12870.1 | 5e-40 | myb domain protein 46 |
Publications ? help Back to Top | |||
---|---|---|---|
|