PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_icon17068474_o.1.g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 65aa MW: 7239.33 Da PI: 9.2355 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 82.6 | 5.8e-26 | 1 | 64 | 27 | 90 |
DUF260 27 pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 p+kfanvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l FANhyb_icon17068474_o.1.g00001.1 1 PHKFANVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVLRL 64 589*********************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 16.048 | 1 | 65 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.0E-25 | 1 | 65 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 65 aa Download sequence Send to blast |
PHKFANVHKI FGASNVSKLL NEVLPHQRED AVNSLAYEAE ARIKDPVYGC VGAISVLQRQ 60 VLRLQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-37 | 1 | 65 | 37 | 101 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-37 | 1 | 65 | 37 | 101 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004304650.1 | 2e-40 | PREDICTED: LOB domain-containing protein 25 | ||||
Swissprot | Q9FML4 | 1e-37 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A2P6S5S2 | 5e-39 | A0A2P6S5S2_ROSCH; Putative transcription factor AS2-LOB family | ||||
STRING | XP_004304650.1 | 6e-40 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1091 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 4e-40 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|