PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00035201_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HSF
Protein Properties Length: 74aa    MW: 7473.12 Da    PI: 3.4015
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00035201_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind26.71.5e-084574231
                                      HHHHHHHHHCTGGGTTTSEESSSSSEEEES CS
                      HSF_DNA-bind  2 Flkklyeiledeelkeliswsengnsfvvl 31
                                      Fl+k+y++++d+++++++sws ++nsfvv+
  FANhyb_icon00035201_a.1.g00001.1 45 FLSKTYDMVDDPATDSIVSWSPTNNSFVVW 74
                                      9********************999****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.3E-103974IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467855.98E-84074IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004475.3E-64574IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MLMAGTSTNP DESTAGGGAQ TSAAGGSDSA PAPTPLLNSN APPPFLSKTY DMVDDPATDS  60
IVSWSPTNNS FVVW
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat stress. {ECO:0000269|PubMed:7948881}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300222.13e-35PREDICTED: heat shock factor protein HSF8
SwissprotP411515e-18HFA1A_ARATH; Heat stress transcription factor A-1a
TrEMBLA0A1W6LWH01e-34A0A1W6LWH0_FRAAN; Heat shock transcription factor protein 1
STRINGXP_004300222.11e-34(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15923395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17750.11e-18heat shock factor 1
Publications ? help Back to Top
  1. Hsu SF,Jinn TL
    AtHSBP functions in seed development and the motif is required for subcellular localization and interaction with AtHSFs.
    Plant Signal Behav, 2010. 5(8): p. 1042-4
    [PMID:20657173]
  2. Liu HC,Charng YY
    Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development.
    Plant Physiol., 2013. 163(1): p. 276-90
    [PMID:23832625]
  3. Li S, et al.
    HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis.
    Plant Cell, 2014. 26(4): p. 1764-1780
    [PMID:24728648]
  4. Muench M,Hsin CH,Ferber E,Berger S,Mueller MJ
    Reactive electrophilic oxylipins trigger a heat stress-like response through HSFA1 transcription factors.
    J. Exp. Bot., 2016. 67(21): p. 6139-6148
    [PMID:27811081]