![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_icon00010638_a.1.g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 156aa MW: 18372.1 Da PI: 9.8598 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 155.2 | 2.8e-48 | 12 | 138 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 pGfrFhPt+eel+ +yLk v gk+l++ ++i+ ++iy+++PwdLp k +e+ewyfF++rd+k+ +g r+nr+t+ FANhyb_icon00010638_a.1.g00001.1 12 PGFRFHPTEEELLEFYLKSVVFGKRLRF-DIIEFLNIYRHDPWDLPGLSKIGEREWYFFVPRDRKHGSGGRPNRTTE 87 9*************************99.99***************8778899************************ PP NAM 80 sgyWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g+Wkatg+d++++s ++ +gl+ktLvfykgrap+g+ktdWvm+eyrl FANhyb_icon00010638_a.1.g00001.1 88 TGFWKATGSDRKIVSLsdPKRIIGLRKTLVFYKGRAPRGTKTDWVMNEYRL 138 *************997666778***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 50.888 | 10 | 156 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.23E-53 | 11 | 141 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.9E-25 | 12 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009965 | Biological Process | leaf morphogenesis | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0045792 | Biological Process | negative regulation of cell size | ||||
GO:0048281 | Biological Process | inflorescence morphogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MASEMTPELE LPGFRFHPTE EELLEFYLKS VVFGKRLRFD IIEFLNIYRH DPWDLPGLSK 60 IGEREWYFFV PRDRKHGSGG RPNRTTETGF WKATGSDRKI VSLSDPKRII GLRKTLVFYK 120 GRAPRGTKTD WVMNEYRLPD HCKLLKVDFD ASQFSL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-47 | 1 | 138 | 3 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004290041.1 | 1e-105 | PREDICTED: NAC transcription factor 29 | ||||
Swissprot | Q10S65 | 9e-80 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
TrEMBL | A0A2P6S9T9 | 1e-104 | A0A2P6S9T9_ROSCH; Putative transcription factor NAM family | ||||
STRING | XP_004290041.1 | 1e-105 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6214 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 2e-85 | NAC domain containing protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|