PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

SBP

Protein Properties

Length: 141aa MW: 15073.9 Da PI: 8.6782

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_icon00004730_a.1.g00001.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	81.7	9.9e-26	78	130	1	53
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 +CqvegC++dls++k y++rhkvC +hsk+p+v+v+gleqrfCqqCsr++ + FANhyb_icon00004730_a.1.g00001.1 78 RCQVEGCNVDLSDVKAYYSRHKVCAMHSKTPTVVVAGLEQRFCQQCSRYYFYT 130 6***********************************************98765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	3.2E-26	73	126	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.62E-25	76	132	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	19.247	76	141	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.5E-19	79	126	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 141 aa Download sequence Send to blast
MGSTSLTTTT DSGGSSSSSP PNNNSTDDSL HGLKFGRKIY FEDGTLAPPK SGSSSSAGAK 60 KQRSSGGGGF VHHGQPPRCQ VEGCNVDLSD VKAYYSRHKV CAMHSKTPTV VVAGLEQRFC 120 QQCSRYYFYT IFALSICLLC F

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj0_A	9e-17	74	132	1	59	squamosa promoter-binding protein-like 12
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR157. {ECO:0000305\|PubMed:12202040}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004304380.2	2e-66	PREDICTED: squamosa promoter-binding-like protein 9
Swissprot	Q9M2Q6	2e-27	SPL15_ARATH; Squamosa promoter-binding-like protein 15
TrEMBL	G9JWE9	2e-84	G9JWE9_FRAAN; SQUAMOSA promoter binding protein-like protein
STRING	XP_004304380.1	4e-66	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF4208	33	59

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57920.1	7e-26	squamosa promoter binding protein-like 15

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Morea EG, et al. Functional and evolutionary analyses of the miR156 and miR529 families in land plants. BMC Plant Biol., 2016. 16: p. 40 [PMID:26841873] Hyun Y, et al. Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem. Dev. Cell, 2016. 37(3): p. 254-66 [PMID:27134142] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584]