PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.F02146.2.p | ||||||||
Common Name | EUGRSUZ_F02146, LOC104449179 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 25007.9 Da PI: 9.3826 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.2 | 7.9e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + r vtfskRr g++KKA+ELSvLCda+v++iifs tgklye+ss Eucgr.F02146.2.p 9 KKIDNVMARRVTFSKRRRGLIKKAQELSVLCDADVSLIIFSATGKLYEFSS 59 689**********************************************96 PP | |||||||
2 | K-box | 42.9 | 2.1e-15 | 87 | 170 | 15 | 98 |
K-box 15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++ + +l+ L+ke++ ++R+++GedLe+L+++ L+qLe++Le +l+ + ++ +e ++i+elq ke +l +enk+L++k+ Eucgr.F02146.2.p 87 QKDSSNLEMLRKEVNDKAYKLRQMKGEDLERLDVEGLRQLEKKLEAGLSLVIKTEEERASTKINELQGKEAQLIKENKQLKQKM 170 66777888999999999999*************************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.6E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.857 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.04E-36 | 2 | 69 | No hit | No description |
SuperFamily | SSF55455 | 2.49E-30 | 2 | 74 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.232 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.0E-13 | 89 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MGREKIKIKK IDNVMARRVT FSKRRRGLIK KAQELSVLCD ADVSLIIFSA TGKLYEFSSS 60 SMEDTLTRYV LHSNIVEKPV QPCLSLQKDS SNLEMLRKEV NDKAYKLRQM KGEDLERLDV 120 EGLRQLEKKL EAGLSLVIKT EEERASTKIN ELQGKEAQLI KENKQLKQKM ILHRGKSVIV 180 NSEDNNVVLE VEGVLLELVN NVAVGSSSVA PLDDDRFHPS S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-19 | 1 | 73 | 1 | 73 | MEF2C |
5f28_B | 3e-19 | 1 | 73 | 1 | 73 | MEF2C |
5f28_C | 3e-19 | 1 | 73 | 1 | 73 | MEF2C |
5f28_D | 3e-19 | 1 | 73 | 1 | 73 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.F02146.2.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018731854.1 | 1e-158 | PREDICTED: MADS-box protein SVP isoform X2 | ||||
Refseq | XP_018731855.1 | 1e-158 | PREDICTED: MADS-box protein SVP isoform X2 | ||||
Swissprot | Q9FVC1 | 9e-62 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A059BQR7 | 1e-157 | A0A059BQR7_EUCGR; Uncharacterized protein | ||||
STRING | XP_010061535.1 | 1e-155 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 3e-62 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.F02146.2.p |
Entrez Gene | 104449179 |