![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.E04355.1.p | ||||||||
Common Name | EUGRSUZ_E02018, LOC104444675, LOC104445858 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 127aa MW: 13951.8 Da PI: 7.249 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 135.6 | 1.9e-42 | 15 | 112 | 1 | 98 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 aCaaCk+lrr+C +dC +apyfpa++p+kf nvhk+FGasnv k+l++lpe++r +++sslvyeA+ar+rdPv+G+vg i++lq+ql+ + ae Eucgr.E04355.1.p 15 ACAACKLLRRRCMQDCLFAPYFPASEPHKFTNVHKVFGASNVNKMLQDLPEDQRANTVSSLVYEANARVRDPVNGCVGEITALQSQLADKIAE 107 7****************************************************************************************9999 PP DUF260 94 lallk 98 +++l+ Eucgr.E04355.1.p 108 VERLQ 112 98775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.888 | 14 | 115 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.3E-41 | 15 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MEESSEGRNR GTPLACAACK LLRRRCMQDC LFAPYFPASE PHKFTNVHKV FGASNVNKML 60 QDLPEDQRAN TVSSLVYEAN ARVRDPVNGC VGEITALQSQ LADKIAEVER LQVLLEAEKS 120 NRSPSS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-40 | 11 | 120 | 7 | 109 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-40 | 11 | 120 | 7 | 109 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.E04355.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010056712.1 | 9e-90 | PREDICTED: LOB domain-containing protein 4 | ||||
Refseq | XP_010058105.1 | 9e-90 | PREDICTED: LOB domain-containing protein 4 | ||||
Swissprot | Q9SHE9 | 1e-47 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A059C5K5 | 2e-88 | A0A059C5K5_EUCGR; Uncharacterized protein | ||||
STRING | XP_010056712.1 | 3e-89 | (Eucalyptus grandis) | ||||
STRING | XP_010058105.1 | 3e-89 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 4e-50 | LOB domain-containing protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.E04355.1.p |
Entrez Gene | 104444675 | 104445858 |