PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.C02487.1.p | ||||||||
Common Name | EUGRSUZ_C02487 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 127aa MW: 12998.2 Da PI: 8.5126 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 29.4 | 1.7e-09 | 16 | 45 | 30 | 59 |
TT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 30 agCpvkkkversaedpkvveitYegeHnhe 59 agCpv+k++e++ ++ ++v+itY+g H+h+ Eucgr.C02487.1.p 16 AGCPVRKQIETAVDNANAVIITYKGVHDHD 45 58***************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 12.438 | 6 | 47 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.62E-7 | 16 | 47 | IPR003657 | WRKY domain |
SMART | SM00774 | 0.0041 | 16 | 46 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 2.8E-8 | 16 | 47 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.4E-5 | 17 | 44 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MVVVACVHGV ALLVLAGCPV RKQIETAVDN ANAVIITYKG VHDHDMPVPK KRHRPPSAPL 60 VAAAAPASMS SAPHKKVDAA QNGKASTKLS VDAGGELTGE VMELGGEKAM ESARTLLSIG 120 IEIKPC* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.C02487.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010048804.1 | 3e-69 | PREDICTED: probable WRKY transcription factor 32 isoform X2 | ||||
Swissprot | P59583 | 6e-37 | WRK32_ARATH; Probable WRKY transcription factor 32 | ||||
TrEMBL | A0A059CRK8 | 7e-85 | A0A059CRK8_EUCGR; Uncharacterized protein | ||||
STRING | XP_010048803.1 | 2e-68 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6338 | 28 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G30935.1 | 5e-29 | WRKY DNA-binding protein 32 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.C02487.1.p |