![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.B03514.1.p | ||||||||
Common Name | EUGRSUZ_B03514 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 186aa MW: 20317.6 Da PI: 11.3447 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.5 | 2.2e-25 | 122 | 172 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien+s rqvtfskRrng++KKA EL +LCd+ev++++fss+gk y ++s Eucgr.B03514.1.p 122 KRIENNSSRQVTFSKRRNGLIKKARELAILCDVEVSLLVFSSRGKPYVFCS 172 79*******************************************999986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.469 | 114 | 174 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 5.1E-35 | 114 | 173 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.83E-33 | 115 | 178 | No hit | No description |
SuperFamily | SSF55455 | 6.67E-27 | 115 | 174 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-25 | 116 | 136 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.0E-25 | 123 | 170 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-25 | 136 | 151 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-25 | 151 | 172 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MRVGGKREQN GRVFLIFPSF FPFSGDYGER RIASASSLLH LLAGSLAFES APGLGQREGD 60 IASAGDSIFF SSFPFPLIFP LSLSLSLVGP PQTQRSLSLS LAVSSRFGRV GEKMGRKKLV 120 LKRIENNSSR QVTFSKRRNG LIKKARELAI LCDVEVSLLV FSSRGKPYVF CSGNNRCVPL 180 HLLLH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-14 | 114 | 174 | 1 | 61 | MEF2C |
5f28_B | 1e-14 | 114 | 174 | 1 | 61 | MEF2C |
5f28_C | 1e-14 | 114 | 174 | 1 | 61 | MEF2C |
5f28_D | 1e-14 | 114 | 174 | 1 | 61 | MEF2C |
6byy_A | 1e-14 | 114 | 174 | 1 | 61 | MEF2 CHIMERA |
6byy_B | 1e-14 | 114 | 174 | 1 | 61 | MEF2 CHIMERA |
6byy_C | 1e-14 | 114 | 174 | 1 | 61 | MEF2 CHIMERA |
6byy_D | 1e-14 | 114 | 174 | 1 | 61 | MEF2 CHIMERA |
6bz1_A | 1e-14 | 114 | 174 | 1 | 61 | MEF2 CHIMERA |
6bz1_B | 1e-14 | 114 | 174 | 1 | 61 | MEF2 CHIMERA |
6bz1_C | 1e-14 | 114 | 174 | 1 | 61 | MEF2 CHIMERA |
6bz1_D | 1e-14 | 114 | 174 | 1 | 61 | MEF2 CHIMERA |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.B03514.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010044832.2 | 1e-121 | PREDICTED: MADS-box protein FLOWERING LOCUS C isoform X1 | ||||
TrEMBL | A0A059D911 | 1e-127 | A0A059D911_EUCGR; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G10140.2 | 3e-26 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.B03514.1.p |