![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.B01300.1.p | ||||||||
Common Name | EUGRSUZ_B01300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 121aa MW: 13591.5 Da PI: 5.9497 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 155.7 | 7.6e-49 | 13 | 108 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 +eqdr+lPianv+rimk+vlP nakisk++ket+qecvsefi+fvtseas+kc++e+rkt+ngdd++ a+ t+Gf+dy+ l+ yl+ yr le Eucgr.B01300.1.p 13 KEQDRLLPIANVGRIMKQVLPPNAKISKQTKETMQECVSEFIGFVTSEASEKCRKERRKTVNGDDICCAMETMGFDDYAGLLRRYLHIYRGLE 105 89******************************************************************************************* PP NF-YB 95 gek 97 gek Eucgr.B01300.1.p 106 GEK 108 997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-46 | 8 | 118 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.45E-35 | 15 | 117 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.7E-25 | 18 | 82 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.4E-14 | 46 | 64 | No hit | No description |
PRINTS | PR00615 | 6.4E-14 | 65 | 83 | No hit | No description |
PRINTS | PR00615 | 6.4E-14 | 84 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MEDNIGSDEG SIKEQDRLLP IANVGRIMKQ VLPPNAKISK QTKETMQECV SEFIGFVTSE 60 ASEKCRKERR KTVNGDDICC AMETMGFDDY AGLLRRYLHI YRGLEGEKAN QVKAMNNTQQ 120 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-41 | 12 | 102 | 1 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-41 | 12 | 102 | 1 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.B01300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010037376.1 | 7e-69 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 1e-53 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A059D2P9 | 2e-84 | A0A059D2P9_EUCGR; Uncharacterized protein | ||||
STRING | XP_010037234.1 | 1e-73 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 5e-56 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.B01300.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|