![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS781666.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 128aa MW: 13449.4 Da PI: 8.8606 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 53.5 | 4.8e-17 | 6 | 47 | 18 | 59 |
-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 18 sefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 s + r+YYrCtsagCpv+k++e++ ++ ++v+itY+g H+h+ EcS781666.10 6 SANFRNYYRCTSAGCPVRKQIETAVDNANAVIITYKGVHDHD 47 6678*************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 17.832 | 1 | 49 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 2.1E-15 | 6 | 49 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.2E-8 | 6 | 48 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.5E-11 | 7 | 46 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.75E-14 | 7 | 49 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MAFMMSANFR NYYRCTSAGC PVRKQIETAV DNANAVIITY KGVHDHDMPV PKKRHGPPSA 60 PLVAAAAPAS MSSAQNKKVD AAQNGKASTK LSVDAGGELT GEAMELGGEK AMESARTLLS 120 IGIEIKPC |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010048803.1 | 5e-77 | PREDICTED: probable WRKY transcription factor 32 isoform X1 | ||||
Swissprot | P59583 | 6e-47 | WRK32_ARATH; Probable WRKY transcription factor 32 | ||||
TrEMBL | A0A059CRS3 | 1e-75 | A0A059CRS3_EUCGR; Uncharacterized protein | ||||
STRING | XP_010048803.1 | 2e-76 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6338 | 28 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G30935.1 | 2e-38 | WRKY DNA-binding protein 32 |