PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS766893.10
Organism
Eucalyptus camaldulensis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 51aa    MW: 5868.89 Da    PI: 9.1585
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS766893.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.13.5e-261411151
                  HHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF 11 vtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  vtfskRr+g+lKKA+ELSvLCdaeva+iifs++g+lye+ss
  EcS766893.10  1 VTFSKRRTGLLKKAYELSVLCDAEVAMIIFSQKGRLYEFSS 41
                  8**************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.324143IPR002100Transcription factor, MADS-box
PfamPF003191.6E-22139IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-21145IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-17142IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-19520IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-192041IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 51 aa     Download sequence    Send to blast
VTFSKRRTGL LKKAYELSVL CDAEVAMIIF SQKGRLYEFS SNSEYVHILI L
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers.
UniProtTranscriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:24121311}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035067.13e-23PREDICTED: MADS-box protein AGL42
SwissprotQ015401e-18AG_BRANA; Floral homeotic protein AGAMOUS
SwissprotQ388388e-19AGL14_ARATH; Agamous-like MADS-box protein AGL14
SwissprotQ9FIS16e-19AGL42_ARATH; MADS-box protein AGL42
TrEMBLA0A058ZX092e-23A0A058ZX09_EUCGR; Uncharacterized protein
TrEMBLA0A058ZY836e-22A0A058ZY83_EUCGR; Uncharacterized protein
STRINGXP_010035067.11e-22(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.42e-21AGAMOUS-like 42
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Qu Y, et al.
    Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]