![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS763394.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 120aa MW: 13793.7 Da PI: 9.5232 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 108.2 | 6.3e-34 | 15 | 111 | 1 | 97 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 aCa+Ck++r+kC ++Cvl+pyfpae++ +f++vh ++G+snv+k++ a++e++r+ +++sl++eA+ r++dPv+Ga++ ++++q++l+ k+ l+++ EcS763394.10 15 ACASCKHQRKKCDEKCVLSPYFPAEKSVEFQAVHGVYGVSNVTKMVLAVREQDRRWVADSLIWEARHRQQDPVHGAFAEYQRIQNELQYYKSLLQKQ 111 7**************************************************************************************9999877655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 21.44 | 14 | 115 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.9E-32 | 15 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MHRPINNGIG GTHAACASCK HQRKKCDEKC VLSPYFPAEK SVEFQAVHGV YGVSNVTKMV 60 LAVREQDRRW VADSLIWEAR HRQQDPVHGA FAEYQRIQNE LQYYKSLLQK QAIQSQRLQG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-19 | 11 | 101 | 7 | 97 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-19 | 11 | 101 | 7 | 97 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00128 | DAP | Transfer from AT1G06280 | Download |
![]() |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010038683.1 | 7e-85 | PREDICTED: LOB domain-containing protein 12 | ||||
Swissprot | Q9LNB9 | 1e-42 | LBD2_ARATH; LOB domain-containing protein 2 | ||||
TrEMBL | A0A286R6G5 | 5e-84 | A0A286R6G5_EUCGR; LOB domain-containing protein 12-like | ||||
STRING | XP_010038683.1 | 3e-84 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10539 | 26 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06280.1 | 6e-45 | LOB domain-containing protein 2 |