PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Gene Ontology |

Regulation |

Orthologous Group |

Publication

Basic Information? help Back to Top

TF ID

EcS513387.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 74aa MW: 8514.65 Da PI: 8.505

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS513387.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	35.5	2.3e-11	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT++Ed++l+d+++++G g+W++ ++ g EcS513387.10 14 KGAWTKQEDQKLIDYIHKHGEGCWRSLPQAAG 45 79***********************9998766 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.3E-11	6	43	IPR009057	Homeodomain-like
PROSITE profile	PS51294	9.195	9	56	IPR017930	Myb domain
SuperFamily	SSF46689	3.04E-8	11	45	IPR009057	Homeodomain-like
Pfam	PF00249	9.7E-10	14	45	IPR001005	SANT/Myb domain
CDD	cd00167	1.69E-6	16	46	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 74 aa Download sequence Send to blast
MRKPCCEKKG TMNKGAWTKQ EDQKLIDYIH KHGEGCWRSL PQAAGTFVHE FLHFSSPRRF 60 ETAVGPETYV TSET

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010032675.1	4e-27	PREDICTED: transcription factor MYB3
Swissprot	Q9S9K9	9e-19	MYB3_ARATH; Transcription factor MYB3
TrEMBL	A0A059D087	9e-26	A0A059D087_EUCGR; Uncharacterized protein
STRING	XP_010032675.1	2e-26	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	4e-21	myb domain protein 3

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]