![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC073358.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 58aa MW: 6767.48 Da PI: 8.4912 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 36.5 | 1.4e-11 | 12 | 55 | 54 | 98 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 + ++w+fF++r++++ +g r++r t++gyWkatg+ v+s +++ EcC073358.10 12 DPEQWFFFIPRQESEYRGGRPRRLTTTGYWKATGSPGFVYS-NNH 55 5579********************************99999.554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 16.176 | 1 | 58 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 4.84E-12 | 8 | 58 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 58 aa Download sequence Send to blast |
DPEFAGDLCR RDPEQWFFFI PRQESEYRGG RPRRLTTTGY WKATGSPGFV YSNNHIVG |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010024757.1 | 8e-35 | PREDICTED: NAC domain-containing protein 90 | ||||
Swissprot | Q9M290 | 1e-19 | NAC61_ARATH; Putative NAC domain-containing protein 61 | ||||
TrEMBL | A0A059DJF0 | 2e-33 | A0A059DJF0_EUCGR; Uncharacterized protein | ||||
STRING | XP_010024757.1 | 3e-34 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10159 | 10 | 34 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G44350.1 | 7e-15 | NAC domain containing protein 61 |