![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC055207.130 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 174aa MW: 19660.7 Da PI: 8.8975 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 66.5 | 2.7e-21 | 12 | 53 | 4 | 45 |
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 ++ rqvtfskRr+g++KKA+EL +LC++++a+i+fs+ gk EcC055207.130 12 TDSCTRQVTFSKRRTGLFKKANELAILCAVQIAIIVFSPGGK 53 57889**********************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 25.623 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.96E-27 | 1 | 72 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.5E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.06E-33 | 2 | 74 | No hit | No description |
PRINTS | PR00404 | 2.8E-19 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.4E-23 | 12 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-19 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-19 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006412 | Biological Process | translation | ||||
GO:0006633 | Biological Process | fatty acid biosynthetic process | ||||
GO:0006812 | Biological Process | cation transport | ||||
GO:0055085 | Biological Process | transmembrane transport | ||||
GO:0005840 | Cellular Component | ribosome | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003735 | Molecular Function | structural constituent of ribosome | ||||
GO:0015299 | Molecular Function | solute:proton antiporter activity | ||||
GO:0016747 | Molecular Function | transferase activity, transferring acyl groups other than amino-acyl groups | ||||
GO:0030170 | Molecular Function | pyridoxal phosphate binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MGRRKIEIQM VTDSCTRQVT FSKRRTGLFK KANELAILCA VQIAIIVFSP GGKPFSFGHP 60 NVESILHRFL NQEKTPDEGT SKDAKSRDES ANDENLNQQL LDLLKRLNAE EKRGEMLEKM 120 VKAKRAAKGQ PLGLPELGEL KRSLEDLREK LRDRMDEIEG CSALLLLAEN QPMI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-16 | 1 | 83 | 1 | 83 | MEF2C |
5f28_B | 4e-16 | 1 | 83 | 1 | 83 | MEF2C |
5f28_C | 4e-16 | 1 | 83 | 1 | 83 | MEF2C |
5f28_D | 4e-16 | 1 | 83 | 1 | 83 | MEF2C |
6byy_A | 3e-16 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
6byy_B | 3e-16 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
6byy_C | 3e-16 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
6byy_D | 3e-16 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010054263.1 | 1e-112 | PREDICTED: agamous-like MADS-box protein AGL29 | ||||
TrEMBL | A0A059CDG3 | 1e-110 | A0A059CDG3_EUCGR; Uncharacterized protein | ||||
STRING | XP_010054263.1 | 1e-111 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34440.1 | 2e-34 | AGAMOUS-like 29 |