 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
EcC055076.40 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
| Family |
MYB |
| Protein Properties |
Length: 100aa MW: 11493.3 Da PI: 11.1502 |
| Description |
MYB family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| EcC055076.40 | genome | ECGD | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 54.7 | 2.2e-17 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+ +WT+eEd +l+++++ G ++W +Ia++ g++R++k+c++rw +yl
EcC055076.40 10 KEAWTAEEDRKLAEVIAVSGARRWQAIAAKAGLNRSGKSCRLRWMNYL 57
579*******************************************97 PP
|
| 2 | Myb_DNA-binding | 37.2 | 6.9e-12 | 63 | 100 | 1 | 40 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++
EcC055076.40 63 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEI 100
78999*****************.*********.*****86 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0007005 | Biological Process | mitochondrion organization |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0004842 | Molecular Function | ubiquitin-protein transferase activity |
| GO:0005515 | Molecular Function | protein binding |
| GO:0005524 | Molecular Function | ATP binding |
| GO:0008270 | Molecular Function | zinc ion binding |
| GO:0008483 | Molecular Function | transaminase activity |
| GO:0030170 | Molecular Function | pyridoxal phosphate binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
| Publications
? help Back to Top |
- Chen B,Wang X,Hu Y,Wang Y,Lin Z
Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco.
Mol. Biotechnol., 2004. 26(3): p. 187-92
[PMID:15004287] - Paz-Ares J,Ghosal D,Saedler H
Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus.
EMBO J., 1990. 9(2): p. 315-21
[PMID:2303027] - Khosla A, et al.
HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23.
Plant Cell, 2014. 26(5): p. 2184-2200
[PMID:24824485] - Yu D, et al.
RPN1a, a subunit of the 26S proteasome, controls trichome development in Arabidopsis.
Plant Physiol. Biochem., 2015. 88: p. 82-8
[PMID:25676129] - Lung SC, et al.
Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
New Phytol., 2018. 218(1): p. 183-200
[PMID:29288621] - Kohanová J, et al.
Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
Ann. Bot., 2018. 122(5): p. 903-914
[PMID:29394308] - Cone KC,Burr FA,Burr B
Molecular analysis of the maize anthocyanin regulatory locus C1.
Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5
[PMID:3025847] - Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H
The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators.
EMBO J., 1987. 6(12): p. 3553-8
[PMID:3428265] - Scheffler B, et al.
Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene.
Mol. Gen. Genet., 1994. 242(1): p. 40-8
[PMID:7904044] - Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
Plant J., 1994. 6(1): p. 21-30
[PMID:7920701] - Singer T,Gierl A,Peterson PA
Three new dominant C1 suppressor alleles in Zea mays.
Genet. Res., 1998. 71(2): p. 127-32
[PMID:9717435]
|
