PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055076.40
Organism
Eucalyptus camaldulensis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 100aa    MW: 11493.3 Da    PI: 11.1502
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055076.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.2e-171057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     + +WT+eEd +l+++++  G ++W +Ia++ g++R++k+c++rw +yl
     EcC055076.40 10 KEAWTAEEDRKLAEVIAVSGARRWQAIAAKAGLNRSGKSCRLRWMNYL 57
                     579*******************************************97 PP
2Myb_DNA-binding37.26.9e-1263100140
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++
     EcC055076.40  63 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEI 100
                      78999*****************.*********.*****86 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.298561IPR017930Myb domain
SuperFamilySSF466892.84E-268100IPR009057Homeodomain-like
SMARTSM007171.0E-14959IPR001005SANT/Myb domain
PfamPF002491.1E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-241264IPR009057Homeodomain-like
CDDcd001671.92E-101257No hitNo description
PROSITE profilePS5129415.19962100IPR017930Myb domain
SMARTSM007170.009662100IPR001005SANT/Myb domain
PfamPF002493.1E-1063100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-1865100IPR009057Homeodomain-like
CDDcd001672.17E-667100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007005Biological Processmitochondrion organization
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004842Molecular Functionubiquitin-protein transferase activity
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
GO:0008270Molecular Functionzinc ion binding
GO:0008483Molecular Functiontransaminase activity
GO:0030170Molecular Functionpyridoxal phosphate binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MEGRIKKINK EAWTAEEDRK LAEVIAVSGA RRWQAIAAKA GLNRSGKSCR LRWMNYLRPN  60
IKRGNISDQE EDLILRLHKL LGNRWSLIAG RLPGRTDNEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-235100296B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064040.16e-66PREDICTED: transcription factor MYB114
SwissprotP102904e-40MYBC_MAIZE; Anthocyanin regulatory C1 protein
SwissprotQ962761e-40MYB23_ARATH; Transcription factor MYB23
TrEMBLA0A059BYQ16e-65A0A059BYQ1_EUCGR; Uncharacterized protein (Fragment)
STRINGXP_010064040.12e-65(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.15e-43myb domain protein 23
Publications ? help Back to Top
  1. Chen B,Wang X,Hu Y,Wang Y,Lin Z
    Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco.
    Mol. Biotechnol., 2004. 26(3): p. 187-92
    [PMID:15004287]
  2. Paz-Ares J,Ghosal D,Saedler H
    Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus.
    EMBO J., 1990. 9(2): p. 315-21
    [PMID:2303027]
  3. Khosla A, et al.
    HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23.
    Plant Cell, 2014. 26(5): p. 2184-2200
    [PMID:24824485]
  4. Yu D, et al.
    RPN1a, a subunit of the 26S proteasome, controls trichome development in Arabidopsis.
    Plant Physiol. Biochem., 2015. 88: p. 82-8
    [PMID:25676129]
  5. Lung SC, et al.
    Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
    New Phytol., 2018. 218(1): p. 183-200
    [PMID:29288621]
  6. Kohanová J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]
  7. Cone KC,Burr FA,Burr B
    Molecular analysis of the maize anthocyanin regulatory locus C1.
    Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5
    [PMID:3025847]
  8. Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H
    The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators.
    EMBO J., 1987. 6(12): p. 3553-8
    [PMID:3428265]
  9. Scheffler B, et al.
    Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene.
    Mol. Gen. Genet., 1994. 242(1): p. 40-8
    [PMID:7904044]
  10. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]
  11. Singer T,Gierl A,Peterson PA
    Three new dominant C1 suppressor alleles in Zea mays.
    Genet. Res., 1998. 71(2): p. 127-32
    [PMID:9717435]